Dataset for protein BCL-2-like of organism Lonchura striata domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A218V8Z6_BCL2A1-      --METAEFYYVYYLAQDYLQYVLQE-------------------------
A0A218UQA0_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRVSLPPDHSASAAAA
A0A218USB3_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF-------
A0A218USB3_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF-------
A0A218USB3_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF-------
A0A218USB3_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF-------
                                     :. .:: * *.:                         

A0A218V8Z6_BCL2A1-      ---------------------------------------SHLGPAQTRVA
A0A218UQA0_BCL2-01      IAAAGTSDHTGLVSPHPE--------PPGSATASHTPPAEGLRPAPQVVH
A0A218USB3_BCL2L1-      --AGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRAAD-VR
A0A218USB3_BCL2L1-      --AGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRAAD-VR
A0A218USB3_BCL2L1-      --AGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRAAD-VR
A0A218USB3_BCL2L1-      --AGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRAAD-VR
                                                                 :  *   * 

A0A218V8Z6_BCL2A1-      HVLRTMASSLQDQTEEAVRPLLDRIDISSVAVAKRIFNGVMDEKFADGNT
A0A218UQA0_BCL2-01      LVLRQAGDEFSRRYQRDFSQMSGQLHLTP-FTARSRFVAVVEELFRDG-V
A0A218USB3_BCL2L1-      QALREAGDEFELRYRRAFSDLTSQLHITP-STAYQSFEQVVNELFRDG-V
A0A218USB3_BCL2L1-      QALREAGDEFELRYRRAFSDLTSQLHITP-STAYQSFEQVVNELFRDG-V
A0A218USB3_BCL2L1-      QALREAGDEFELRYRRAFSDLTSQLHITP-STAYQSFEQVVNELFRDG-V
A0A218USB3_BCL2L1-      QALREAGDEFELRYRRAFSDLTSQLHITP-STAYQSFEQVVNELFRDG-V
                         .**  ...:. .    .  : ..: ::.  .*   *  *::* * ** .

A0A218V8Z6_BCL2A1-      NWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWI
A0A218UQA0_BCL2-01      NWGRIVAFFEFGGVMCVESVNREMFPLV---DNIATWMTEYLNRHLHNWI
A0A218USB3_BCL2L1-      NWGRIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWI
A0A218USB3_BCL2L1-      NWGRIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWI
A0A218USB3_BCL2L1-      NWGRIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWI
A0A218USB3_BCL2L1-      NWGRIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWI
                        *****:::* *** :  :   . :   .   . *  ::* *:  :   **

A0A218V8Z6_BCL2A1-      DANGGWENGFLTKFER---------RSLLSFSRITALFIALVSLFREYY-
A0A218UQA0_BCL2-01      QDNGGWDA-FVELYGNNM-------RPLFDFSWISLKTILSLVLVGACIT
A0A218USB3_BCL2L1-      QENGGWER-FVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLSTRIS
A0A218USB3_BCL2L1-      QENGGWER-FVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGS---
A0A218USB3_BCL2L1-      QENGGWER-FVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGS---
A0A218USB3_BCL2L1-      QENGGWER-FVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLSTDSC
                        : ****:  *:  : .         .  :.   ::   :  : *.     

A0A218V8Z6_BCL2A1-      --------------------
A0A218UQA0_BCL2-01      LGA------------YLGHK
A0A218USB3_BCL2L1-      ISPLNASVCRWR--------
A0A218USB3_BCL2L1-      ---------------LLSRK
A0A218USB3_BCL2L1-      ---------------LLSRK
A0A218USB3_BCL2L1-      CSCRTRSDPAWGARGLALAH
                                            

© 1998-2020Legal notice