Dataset for protein Bcl-2 of organism Larimichthys crocea

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4D6FTA2_BCL2-02      MSSEEGLSSTVTDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A4D6FTA2_BCL2-01      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A4D6FTA2_BCL2-03      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A4D6FTA2_BCL2-04      MSSEEGLSSTVTDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A4D6FTA2_BCL2-05      MANERNRN----------------------IVEKYICHKLSKQGYVWGFD
                                                      :*  :*   :     :  : 

A0A4D6FTA2_BCL2-02      SPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A4D6FTA2_BCL2-01      SPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A4D6FTA2_BCL2-03      SPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A4D6FTA2_BCL2-04      SPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDE-------
A0A4D6FTA2_BCL2-05      DVRDEDAANNGSIVAPPPTLVRRCREASTGPDTESIPH------------
                        . .  .  ..  :*:  .: : .*   .   :   *.             

A0A4D6FTA2_BCL2-02      KEVEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLG--------PV
A0A4D6FTA2_BCL2-01      KEVEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLG--------PV
A0A4D6FTA2_BCL2-03      KEVEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLG--------PV
A0A4D6FTA2_BCL2-04      ------------VVLCISVDVSSDYSQVESVIKQAQEKLG--------PV
A0A4D6FTA2_BCL2-05      --------------LCKRLPQSDPHAAIHRVLREAGDELERLYQPDFTEM
                                      **  :  *. :: :  *:.:* ::*          :

A0A4D6FTA2_BCL2-02      DMLVNCAGTSISGKFEDMDVDRFKKMMEVNYLGSVYPTRAVITTMKERRM
A0A4D6FTA2_BCL2-01      DMLVNCAGTSISGKFEDMDVDRFKKMMEVNYLGSVYPTRAVITTMKERRM
A0A4D6FTA2_BCL2-03      DMLVNCAGTSISGKFEDMDVDRFKKMMEVNYLGSVYPTRAVITTMKERRM
A0A4D6FTA2_BCL2-04      DMLVNCAGTSISGKFEDMDVDRFKI-------------------------
A0A4D6FTA2_BCL2-05      SRQLYLTSTTAQRRFAEV-IDELFR-------------------------
                        .  :  :.*: . .* :: :* :                           

A0A4D6FTA2_BCL2-02      GRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAY
A0A4D6FTA2_BCL2-01      GRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAY
A0A4D6FTA2_BCL2-03      GRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAY
A0A4D6FTA2_BCL2-04      --------------------------------------------------
A0A4D6FTA2_BCL2-05      --------------------------------------------------
                                                                          

A0A4D6FTA2_BCL2-02      PPDTDTPGLAEENKTKPLETKLISETAGVCQPDQVAKIIVRDAVQGNFNS
A0A4D6FTA2_BCL2-01      PPDTDTPGLAEENKTKPLETKLISETAGVCQPDQVAKIIVRDAVQGNFNS
A0A4D6FTA2_BCL2-03      PPDTDTPGLAEENKTKPLETKLISETAGVCQPDQVAKIIVRDAI------
A0A4D6FTA2_BCL2-04      --------------------------------------------------
A0A4D6FTA2_BCL2-05      --------------------------------------------------
                                                                          

A0A4D6FTA2_BCL2-02      SVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR--------------
A0A4D6FTA2_BCL2-01      SVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSI
A0A4D6FTA2_BCL2-03      ---------------------VTMGLFR----------------------
A0A4D6FTA2_BCL2-04      ---------------------VTMGLFR----------------------
A0A4D6FTA2_BCL2-05      ---------------------DGVNWGR----------------------
                                                .  .                      

A0A4D6FTA2_BCL2-02      --TIALFYLGSFDSIVRRCMIQREQSKAADKTE-----------------
A0A4D6FTA2_BCL2-01      KTVFGMAALGAASLTIGAYLTQK---------------------------
A0A4D6FTA2_BCL2-03      --TIALFYLGSFDSIVRRCMIQREQSKAADKTE-----------------
A0A4D6FTA2_BCL2-04      --TIALFYLGSFDSIVRRCMIQREQSKAADKTE-----------------
A0A4D6FTA2_BCL2-05      --IIAFFEFGG--TVCVECVAKEEMTPQVDNIAEWMTEYLNGPLNSWIQD
                           :.:  :*.        : :                            

A0A4D6FTA2_BCL2-02      -------------------------------------------------
A0A4D6FTA2_BCL2-01      -------------------------------------------------
A0A4D6FTA2_BCL2-03      -------------------------------------------------
A0A4D6FTA2_BCL2-04      -------------------------------------------------
A0A4D6FTA2_BCL2-05      NGGWDAFVELYDRQRDSVFSCSWPSIKTVFGMAALGAASLTIGAYLTQK
                                                                         

© 1998-2020Legal notice