Dataset for protein Bcl-w of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5ASL3_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
G5ASL3_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

G5ASL3_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
G5ASL3_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

G5ASL3_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW------
G5ASL3_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
                      ********************************************      

G5ASL3_BCL2L2-02      -----------------------LISRGKMGALIGGWGSCAGKE
G5ASL3_BCL2L2-01      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-
                                             * .   :***:   .  *.* 

© 1998-2020Legal notice