Dataset for protein BCL-2-like of organism Dipodomys ordii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3F3I1_MCL1-01      MFGLRRNAVIGLNFYCGGAGLGAGSGAAAAPGGRLLTAEEASARREAGGG
A0A1S3EPX7_BCL2L1-      ----------------------------MSQSNRELVVD-----------
A0A1S3FYD8_BCL2L2-      -----------------------MATPASAPDTRALVAD-----------
                                                     : . * *..:           

A0A1S3F3I1_MCL1-01      EAGAGIGGSAGASPSTTLAPDARRVARPAPIGAEVPDVTGTPTKRVFFAP
A0A1S3EPX7_BCL2L1-      --------------------------------------------------
A0A1S3FYD8_BCL2L2-      --------------------------------------------------
                                                                          

A0A1S3F3I1_MCL1-01      THRAPTPDEMEAAAAGAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEAS
A0A1S3EPX7_BCL2L1-      ---------------------------FLSYKLSQKGYSWSQFSDVEESR
A0A1S3FYD8_BCL2L2-      ---------------------------FVGYKLRQKGY------------
                                                   :    * :.              

A0A1S3F3I1_MCL1-01      KSSRTDGSLPSTPPPAEEEDDELYRQSLEIICRYLREQATGAKDAKPLGG
A0A1S3EPX7_BCL2L1-      TEDPEGTESEMETPSAINGNPSWHLADSPAVVNGATGHSSSSEAREVIPM
A0A1S3FYD8_BCL2L2-      ------------------------------VCGAGPGEGPAAD-------
                                                      :       ...:.       

A0A1S3F3I1_MCL1-01      AGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
A0A1S3EPX7_BCL2L1-      AAVK-----QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVN
A0A1S3FYD8_BCL2L2-      -PLH-----QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
                                 :::* .** .: ..  :*..:  :* :.     : : .*  

A0A1S3F3I1_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRT
A0A1S3EPX7_BCL2L1-      ELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDH
A0A1S3FYD8_BCL2L2-      ELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETR
                         :* .*  ****:*::: **. :.    . : :  :  : . :.  *   

A0A1S3F3I1_MCL1-01      KRDWLVKQRGWDGFVEFFHVEDLE---------GSIRNVLLAFAGVAGVG
A0A1S3EPX7_BCL2L1-      LEPWIQEHGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLG
A0A1S3FYD8_BCL2L2-      LADWIHSSGGWAEFTALYGDGALEEARRLRE--GNWASVRTVLTGAVALG
                           *: .  **  *. ::               .    .  ..:*.. :*

A0A1S3F3I1_MCL1-01      A----GLAYLIR
A0A1S3EPX7_BCL2L1-      SL------FSRK
A0A1S3FYD8_BCL2L2-      ALVTVGAFFASK
                        :       :  .

© 1998-2020Legal notice