Dataset for protein Bfl1 of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3GTB4_BCL2A1-01        -----------------------------MTDCEFMYIHSLAEDYLQYVL
A0A3L7HT14_BCL2A1-      ------------------------------MACAPMLVHR------GHAP
A0A3L7HT14_BCL2A1-      MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVL
A0A3L7HT14_BCL2A1-      MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVL
                                                        *  * :*        :. 

G3GTB4_BCL2A1-01        KVPTFESAPSK----TSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTA
A0A3L7HT14_BCL2A1-      SLPTASEGDGRGRGGTCHVMAAVAASSAKR--------------------
A0A3L7HT14_BCL2A1-      KVPTFESAPSK----TSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTA
A0A3L7HT14_BCL2A1-      KVPTFESAPSK----TSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTA
                        .:** ... ..    *..*:  **:*  *                     

G3GTB4_BCL2A1-01        RTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQ
A0A3L7HT14_BCL2A1-      ------------------------------SLRAELKQRLRALSAEERLR
A0A3L7HT14_BCL2A1-      RTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQ
A0A3L7HT14_BCL2A1-      RTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQ
                                                       *  :* *   .*..    .

G3GTB4_BCL2A1-01        VSNFVAEFIMNNTAEWIRQNGGW---------------------------
A0A3L7HT14_BCL2A1-      QSHLLTQKVI---------------AHSQYQNSKRISIFLSMQDEIETEE
A0A3L7HT14_BCL2A1-      VSNFVAEFIMNNTAEWIRQNGGW---------------------------
A0A3L7HT14_BCL2A1-      VSNFVAEFIMNNTAEWIRQNGGWVIAHSQYQNSKRISIFLSMQDEIETEE
                         *::::: ::                                        

G3GTB4_BCL2A1-01        ---------EDGFMKKFE--------------------PKSGWVTFLETI
A0A3L7HT14_BCL2A1-      IIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAE
A0A3L7HT14_BCL2A1-      ---------EDGFMKKFE--------------------PKSGWVTFLETI
A0A3L7HT14_BCL2A1-      IIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAE
                                 :  *: .:                     **:.*  .  : 

G3GTB4_BCL2A1-01        GQIWE---------------MLFSPQATLLAREDPGSFDN----------
A0A3L7HT14_BCL2A1-      GDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGK-GYYDTYLKRCVQHQE
A0A3L7HT14_BCL2A1-      GQIWE---------------MLFSPQATLLAREDPGSFDN----------
A0A3L7HT14_BCL2A1-      GDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGK-GYYDTYLKRCVQHQE
                        *: .*               : *. :.. *.* . * :*.          

G3GTB4_BCL2A1-01        -GDHHLVLPFANNSADRT--------------------
A0A3L7HT14_BCL2A1-      VKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCPAS
A0A3L7HT14_BCL2A1-      -GDHHLVLPFANNSADRT--------------------
A0A3L7HT14_BCL2A1-      VKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCPAS
                           : *.*.* :: . ..                    

© 1998-2020Legal notice