Dataset for protein Bfl1 of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3L7HT14_BCL2A1-      MITPSLSSH----LWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYL
A0A3L7HT14_BCL2A1-      MACAPMLVHRGHAPSLPTASEGDGRGRGGTCHVMAAVAASSAKRSLRAEL
A0A3L7HT14_BCL2A1-      MITPSLSSH----LWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYL
                        *  ..:  *      *.   :   . ...  ..*:       :      *

A0A3L7HT14_BCL2A1-      QYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTA
A0A3L7HT14_BCL2A1-      KQRLRALSAEERLRQSHLLTQKVIAHSQYQNSKRISIFL-----------
A0A3L7HT14_BCL2A1-      QYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTA
                        :  *.. : *.   ::  : *.* :  * : .*.:.::*           

A0A3L7HT14_BCL2A1-      RTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQ
A0A3L7HT14_BCL2A1-      -SMQDEIETEEIIKDIFKQGK-----------------------------
A0A3L7HT14_BCL2A1-      RTIFNQVMEKEFEDGIINWGR-----------------------------
                         :: :::  :*: ..*::.*.                             

A0A3L7HT14_BCL2A1-      VSNFVAEFIMNNTAEWIRQNGGWVIAHSQYQNSKRISIFLSMQDEIETEE
A0A3L7HT14_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
                                                                          

A0A3L7HT14_BCL2A1-      IIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAE
A0A3L7HT14_BCL2A1-      ----------ICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAE
A0A3L7HT14_BCL2A1-      ----------IVTV----FAFGGVLLKKLAQ-------------------
                                  *  :    *  . : : .**.                   

A0A3L7HT14_BCL2A1-      GDAREEALSTGGLDLI--FLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQ
A0A3L7HT14_BCL2A1-      GDAREEALSTGGLDLI--FLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQ
A0A3L7HT14_BCL2A1-      ---EQIGLDVGAYKQVSNFVAEFIMNNTAEWIRQNGGWEDGFMKKFEPKS
                            : .*..*. . :  *:. : ::: .:.: .. *: * ::*.   :.

A0A3L7HT14_BCL2A1-      EVKPY--TLALAFKEQICPQVPV---------DEHDMKVDEVLYEDCPAS
A0A3L7HT14_BCL2A1-      EVKPY--TLALAFKEQICPQVPV---------DEHDMKVDEVLYEDCPAS
A0A3L7HT14_BCL2A1-      GWVTFLETIGQIWEMLFSPQATLLAREDPGSFDNGDHHLVLPFANNSADR
                           .:  *:.  ::  :.**..:         *: * ::   : ::..  

A0A3L7HT14_BCL2A1-      -
A0A3L7HT14_BCL2A1-      -
A0A3L7HT14_BCL2A1-      T
                         

© 1998-2020Legal notice