Dataset for protein BCL-2-like of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5RUN8_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-------------------
A0A2K5R5E2_MCL1-04      ---------MFGLQRNAVIGLNLYCGGAGLG-----AGSGGATPPG----
A0A2K5RUN8_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG----------
A0A2K5R5E2_MCL1-03      MFGL------QRNAVIGLNLYC--------GGAGLGAGSGGATPPG----
A0A2K5RIU7_BCL2L10      MADPLRQR--TERLVADYLEYCSREPG------------TPESPPA----
A0A2K5PP81_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDVGAAPPGAAPA
A0A2K5Q6R6_BCL2L1-      MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG----
A0A2K5Q6R6_BCL2L1-      MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG----
A0A2K5Q6R6_BCL2L1-      ----------------MW-----KRTGLRP--------------------
A0A2K5PYQ3_BCL2A1-      MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPS-------------------
A0A2K5PYQ3_BCL2A1-      MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPS-------------------
                                                                          

A0A2K5RUN8_BCL2L2-      --------------------------------------AGPGEGPAADPL
A0A2K5R5E2_MCL1-04      --------------------------GRLLATGAKDTKPMGRSGAASRKA
A0A2K5RUN8_BCL2L2-      ------------------------------------------EGPAADPL
A0A2K5R5E2_MCL1-03      GRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRPPPI
A0A2K5RIU7_BCL2L10      -----------------------------------------------TAE
A0A2K5PP81_BCL2-01      PGIFSSQPGHTPGPAAPRDPVARTSPPSPPAAPAAAATGPALSPVP-PVV
A0A2K5Q6R6_BCL2L1-      ----TDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAV
A0A2K5Q6R6_BCL2L1-      ----TDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAV
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5RUN8_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDEL--FQG-
A0A2K5R5E2_MCL1-04      LETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHV--FSD-
A0A2K5RUN8_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDEL--FQG-
A0A2K5R5E2_MCL1-03      GAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPE
A0A2K5RIU7_BCL2L10      AAVLRATAAGVRKVYRSFFSAYLG----YPGNRVELVARMAEAL--LSDS
A0A2K5PP81_BCL2-01      HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEEL--FRD-
A0A2K5Q6R6_BCL2L1-      KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNEL--FRD-
A0A2K5Q6R6_BCL2L1-      KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNEL--FRD-
A0A2K5Q6R6_BCL2L1-      ----------QKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNEL--FRD-
A0A2K5PYQ3_BCL2A1-      ----KTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETE--FED-
A0A2K5PYQ3_BCL2A1-      ----KTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETE--FED-
                                                            .             

A0A2K5RUN8_BCL2L2-      -G-PNWGRLVAFFVFGAALC------------------AESVNKEMEPLV
A0A2K5R5E2_MCL1-04      -GVTNWGRIVTLIYFGAFVA------------------KHLKTINQESCI
A0A2K5RUN8_BCL2L2-      -G-PNWGRLVAFFVFGAALC------------------AESVNKEMEPLV
A0A2K5R5E2_MCL1-03      PL-GKRPAVLPLLELVGEPG------NGSSTDGSLPSTPPPAEEEEDELY
A0A2K5RIU7_BCL2L10      PG-PTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGNVSRDR
A0A2K5PP81_BCL2-01      -G-VNWGRIVAFFEFGGVMC------------------VESVNREMSPLV
A0A2K5Q6R6_BCL2L1-      -G-VNWGRIVAFFSFGGALC------------------VESVDKEMQVLV
A0A2K5Q6R6_BCL2L1-      -G-VNWGRIVAFFSFGGALC------------------VESVDKEMQVLV
A0A2K5Q6R6_BCL2L1-      -G-VNWGRIVAFFSFGGALC------------------VESVDKEMQVLV
A0A2K5PYQ3_BCL2A1-      -GIINWGRIVTIFAFEGILI------------------KKLLQERIAPDV
A0A2K5PYQ3_BCL2A1-      -GIINWGRIVTIFAFEGILI------------------KKLLQERIAPDV
                            ..  :: :: : .                                 

A0A2K5RUN8_BCL2L2-      G---QVQEWMVAYLETR-------------------------------LA
A0A2K5R5E2_MCL1-04      E---PLAESITDVLVRT-------------------------------KR
A0A2K5RUN8_BCL2L2-      G---QVQEWMVAYLETR-------------------------------LA
A0A2K5R5E2_MCL1-03      R---QSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQR
A0A2K5RIU7_BCL2L10      Q---RLVGLLSSRLVGQ-------------------------------HR
A0A2K5PP81_BCL2-01      D---NIALWMTEYLNRH-------------------------------LH
A0A2K5Q6R6_BCL2L1-      S---RIAAWMATYLNDH-------------------------------LE
A0A2K5Q6R6_BCL2L1-      S---RIAAWMATYLNDH-------------------------------LE
A0A2K5Q6R6_BCL2L1-      S---RIAAWMATYLNDH-------------------------------LE
A0A2K5PYQ3_BCL2A1-      DTYKEISYFVAEYIMNN-------------------------------TG
A0A2K5PYQ3_BCL2A1-      DTYKEISYFVAEYIMNN-------------------------------TG
                                 :   :                                    

A0A2K5RUN8_BCL2L2-      DWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
A0A2K5R5E2_MCL1-04      DWLVKQRGWD----------------------------------------
A0A2K5RUN8_BCL2L2-      DWIHSSGGWA----------------------------------------
A0A2K5R5E2_MCL1-03      NHETAFQGW-----------------------------------------
A0A2K5RIU7_BCL2L10      AWLEAQGGW-----------------------------------------
A0A2K5PP81_BCL2-01      TWIQDNGGWD----------------------------------------
A0A2K5Q6R6_BCL2L1-      PWIQENGGWD----------------------------------------
A0A2K5Q6R6_BCL2L1-      PWIQENGGWD----------------------------------------
A0A2K5Q6R6_BCL2L1-      PWIQENGGWD----------------------------------------
A0A2K5PYQ3_BCL2A1-      EWIRQNGGWE----------------------------------------
A0A2K5PYQ3_BCL2A1-      EWIRQNGGWG----------------------------------------
                         .     **                                         

A0A2K5RUN8_BCL2L2-      VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
A0A2K5R5E2_MCL1-04      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5R5E2_MCL1-03      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5RUN8_BCL2L2-      SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDVKAFIYSSLTQVI
A0A2K5R5E2_MCL1-04      -----------------------------------------GFVEFFHVE
A0A2K5RUN8_BCL2L2-      -----------------------------------------EFTALYGDG
A0A2K5R5E2_MCL1-03      ---------------------------------------------VCGVL
A0A2K5RIU7_BCL2L10      ------------------------------------------VSTRRGTR
A0A2K5PP81_BCL2-01      -----------------------------------------AFVELYGPS
A0A2K5Q6R6_BCL2L1-      -----------------------------------------TFVELYGNN
A0A2K5Q6R6_BCL2L1-      -----------------------------------------TFVELYGNN
A0A2K5Q6R6_BCL2L1-      -----------------------------------------TFVELYGNN
A0A2K5PYQ3_BCL2A1-      -----------------------------------------N--------
A0A2K5PYQ3_BCL2A1-      -----------------------------------------K--------
                                                                          

A0A2K5RUN8_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTT-----------------NYNSSRS
A0A2K5R5E2_MCL1-04      DL-------E---GGIRNVLLAFAGV------------------------
A0A2K5RUN8_BCL2L2-      ALEEARRLRE---GNWASVRTVLTGA------------------------
A0A2K5R5E2_MCL1-03      PCRGPRRWHQKCAAGFCRCCWSRSWF------------------------
A0A2K5RIU7_BCL2L10      GGMGTREGLTHVP------RWLLLLLQDLLLTGIMEKIAGPGFPVMVVNS
A0A2K5PP81_BCL2-01      M-------RPLFDFSWLSLKTLLSLA------------------------
A0A2K5Q6R6_BCL2L1-      AAAESRKGQERFN------RWFLTGM------------------------
A0A2K5Q6R6_BCL2L1-      AAAESRKGQERFN------RWFLTGM------------------------
A0A2K5Q6R6_BCL2L1-      AAAESRKGQERFN------RWFLTGM------------------------
A0A2K5PYQ3_BCL2A1-      ---GFVKKFEPKS------GW----M------------------------
A0A2K5PYQ3_BCL2A1-      --------------------WHSLML------------------------
                                                                          

A0A2K5RUN8_BCL2L2-      RFYSGFNSRPRGRVYRGRARATSWYSPY-
A0A2K5R5E2_MCL1-04      -------AGVGA---------GLAYLIR-
A0A2K5RUN8_BCL2L2-      -------VALGALV-----TVGAFFASK-
A0A2K5R5E2_MCL1-03      --------GISNKI-----AL--------
A0A2K5RIU7_BCL2L10      SIHLLLDTIIRSFK-----IFSPLLPAQL
A0A2K5PP81_BCL2-01      --------LVGACI-----TLGAYLGHK-
A0A2K5Q6R6_BCL2L1-      --------TVAGVV-----LLGSLFSRK-
A0A2K5Q6R6_BCL2L1-      --------TVAGVV-----LLGSLFSRK-
A0A2K5Q6R6_BCL2L1-      --------TVAGVV-----LLGSLFSRK-
A0A2K5PYQ3_BCL2A1-      --------TFLEVTGKICEMLSLLKQYY-
A0A2K5PYQ3_BCL2A1-      --------MLVESVAQKKRKMAL------
                                                     

© 1998-2020Legal notice