Dataset for protein Mcl-1 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-01      ------------MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAG
A5PJR2_MCL1-01          ------------MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAG
A0A4W2D770_MCL1-02      ------------MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---
F1MQX4_MCL1-01          GMLPIFSEEEEDELYWQSLEIISRYL------------------REQ---
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-01      KEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDV
A5PJR2_MCL1-01          KEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDV
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-01      TATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPA
A5PJR2_MCL1-01          TATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPA
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
                                                                          

A0A4W2CQV1_MCL1-01      ---------------------------MCEEEEDELYWQSLEIISRYLRE
A0A4W2G6Q5_MCL1-01      ---------------------------MCEEEEDELYWQSLEIISRYLRE
A0A4W2D770_MCL1-01      VRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLRE
A5PJR2_MCL1-01          VRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLRE
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
                                                                          

A0A4W2CQV1_MCL1-01      QATGAKDVKPLGRSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIK
A0A4W2G6Q5_MCL1-01      QATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIK
A0A4W2D770_MCL1-01      QATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
A5PJR2_MCL1-01          QATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
A0A4W2D770_MCL1-02      -ATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
F1MQX4_MCL1-01          -ATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIK
                         ******.**** **:*********.*******.**********.*****

A0A4W2CQV1_MCL1-01      NEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIE
A0A4W2G6Q5_MCL1-01      NEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIE
A0A4W2D770_MCL1-01      NEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE
A5PJR2_MCL1-01          NEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE
A0A4W2D770_MCL1-02      NEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE
F1MQX4_MCL1-01          NEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIE
                        ****************** ********************:**********

A0A4W2CQV1_MCL1-01      PLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGV
A0A4W2G6Q5_MCL1-01      PLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGV
A0A4W2D770_MCL1-01      PLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGV
A5PJR2_MCL1-01          PLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGV
A0A4W2D770_MCL1-02      PLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGV
F1MQX4_MCL1-01          PLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGV
                        ********************:*****************************

A0A4W2CQV1_MCL1-01      AGVGAGLAYLIR
A0A4W2G6Q5_MCL1-01      AGVGAGLAYLIR
A0A4W2D770_MCL1-01      AGVGAGLAYLIR
A5PJR2_MCL1-01          AGVGAGLAYLIR
A0A4W2D770_MCL1-02      AGVGAGLAYLIR
F1MQX4_MCL1-01          AGVGAGLAYLIR
                        ************

© 1998-2021Legal notice