Dataset for protein Bcl2l10 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1MV39_BCL2L10-01       VADGQESLV----ERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVA
A0A4W2C0F3_BCL2L10      SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPVPAPSTPEAAVLRHVA
A0A4W2FG99_BCL2L10      SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVA
A0A4W2EB77_BCL2L10      -------MVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVA
E1B9B3_BCL2L10-01       -MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVA
                               :*    *********************.***************

F1MV39_BCL2L10-01       ARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTF
A0A4W2C0F3_BCL2L10      ARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTF
A0A4W2FG99_BCL2L10      ARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTF
A0A4W2EB77_BCL2L10      ARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTF
E1B9B3_BCL2L10-01       ARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTF
                        **************************************************

F1MV39_BCL2L10-01       AGSLLERPPQTTRRQ-KRDDDGVSRDCRLLVALLCAQFCERHRAWLMANG
A0A4W2C0F3_BCL2L10      AGSLLERPPQTTRRQ-KRDDDGVSRDCRLLVALLCAQFCERHRAWLMANG
A0A4W2FG99_BCL2L10      AGSLLERPPQTTRRQ-KRDDDGVSRDCRLLVALLCAQFCERHRAWLMANG
A0A4W2EB77_BCL2L10      AGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNG
E1B9B3_BCL2L10-01       AGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNG
                        *************** *******************************:**

F1MV39_BCL2L10-01       GWDG-------------------FCLFFSQSFQPSWERQLVWFFLAYW--
A0A4W2C0F3_BCL2L10      GWDG-------------------FCLFFSQSFQPSWERQLVWFFLAYW--
A0A4W2FG99_BCL2L10      GWDG-------------------FCLFFSQSFQPSWERQLVWFFLAYW--
A0A4W2EB77_BCL2L10      GWDG-------------------FCLFFPL-IPPSWERQLVWFFLSYW--
E1B9B3_BCL2L10-01       GWVSAKDAGLVGSLGRAHAAGWILSLLQPL-IPAILGKTAGLVFPLILDS
                        ** .                   :.*: .  : .   .    .*      

F1MV39_BCL2L10-01       ------------TAIIIIYFWIKLL-------------------------
A0A4W2C0F3_BCL2L10      ------------TAIIIIYFWIKLL-------------------------
A0A4W2FG99_BCL2L10      ------------TAIIIIYFWIKLL-------------------------
A0A4W2EB77_BCL2L10      ------------TAIIIIYFWIKLS-------------------------
E1B9B3_BCL2L10-01       NNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPSETFLSAFM
                                    :: *:*   :.*                          

© 1998-2021Legal notice