Dataset for protein Bfl1 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2DYC0_BCL2A1-      MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVER
Q3C2I0_BCL2A1-01        MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVER
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      TLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILT
Q3C2I0_BCL2A1-01        TLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILT
A0A4W2DYC0_BCL2A1-      ------------------------MEKEFEDGIVNWGRIVTIFAFEGILT
A0A4W2DYC0_BCL2A1-      -----------------------------------MAAAVAVSGAKRSLR
                                                            .  *:: . :  * 

A0A4W2DYC0_BCL2A1-      KKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGW----------
Q3C2I0_BCL2A1-01        KKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGW----------
A0A4W2DYC0_BCL2A1-      KKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWVFTHNEYQKS
A0A4W2DYC0_BCL2A1-      AELKQRLRALSAEERLRQSHLLAQ---------------KVFTHNEYQKS
                         :*  .  * . :     *.::*:               .          

A0A4W2DYC0_BCL2A1-      --------------------------ENGFVKKFETKSGWLTFLEVTG--
Q3C2I0_BCL2A1-01        --------------------------ENGFVKKFETKSGWLTFLEVTG--
A0A4W2DYC0_BCL2A1-      KRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPE
A0A4W2DYC0_BCL2A1-      KRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPE
                                                  :. *: .:: :*..: :::::.  

A0A4W2DYC0_BCL2A1-      -----------------------------------------KICETLCRL
Q3C2I0_BCL2A1-01        -----------------------------------------KICETLCRL
A0A4W2DYC0_BCL2A1-      EIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRG
A0A4W2DYC0_BCL2A1-      EIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRG
                                                                 * .: * * 

A0A4W2DYC0_BCL2A1-      KQYY----------------------------------------------
Q3C2I0_BCL2A1-01        KQYY----------------------------------------------
A0A4W2DYC0_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYED
A0A4W2DYC0_BCL2A1-      KGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYED
                        * **                                              

A0A4W2DYC0_BCL2A1-      -
Q3C2I0_BCL2A1-01        -
A0A4W2DYC0_BCL2A1-      S
A0A4W2DYC0_BCL2A1-      S
                         

© 1998-2020Legal notice