Dataset for protein Mcl-1 of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
A0A4W2D770_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
                                                                          

A0A4W2CQV1_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLG
A0A4W2G6Q5_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLG
A0A4W2D770_MCL1-02      ---------------------------------------ATGAKDAKPLG
A0A4W2D770_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
                                                               ******.****

A0A4W2CQV1_MCL1-01      RSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKSLSRVM
A0A4W2G6Q5_MCL1-01      GSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKSLSRVM
A0A4W2D770_MCL1-02      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A4W2D770_MCL1-01      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                         **:*********.*******.**********.*****************

A0A4W2CQV1_MCL1-01      VHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVR
A0A4W2G6Q5_MCL1-01      VHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVR
A0A4W2D770_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A4W2D770_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        ****** ********************:**********************

A0A4W2CQV1_MCL1-01      SKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A4W2G6Q5_MCL1-01      SKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A4W2D770_MCL1-02      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A4W2D770_MCL1-01      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        ********:*****************************************

© 1998-2020Legal notice