Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D770_MCL1-01      -----------MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGK
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASR
A0A4W2D6A3_BCL2L2-      MAAAAAAAAAAGAAGGRGS-----------------GPGRRRHLVPGAGG
A0A4W2GUJ7_BCL2L2-      MAAAAAAAAAAGAAGGRGS-----------------GPGRRRHLVPGAGG
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D770_MCL1-01      EATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVT
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      VRSPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHH
A0A4W2D6A3_BCL2L2-      EAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGA
A0A4W2GUJ7_BCL2L2-      EAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGA
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------MAHAGG
A0A4W2BWN1_BCL2-02      --------------------------------------------MAHAGG
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2EB77_BCL2L10      ----------------------------------------------MVDP
A0A4W2C0F3_BCL2L10      ---------------------------------------SADSLHSMVDP
A0A4W2FG99_BCL2L10      ---------------------------------------SADSLHSMVDP
A0A4W2D770_MCL1-01      ATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDP--LGKRP
A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      PAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPA
A0A4W2D6A3_BCL2L2-      PGPGPGSGAP--------------------GNQEEEEESGL---------
A0A4W2GUJ7_BCL2L2-      PGPGPGSGAP--------------------GNQEEEEESGL---------
                                                                          

A0A4W2CQV1_MCL1-01      ----------------------------MCEEEEDELYWQSLEIISRYLR
A0A4W2G6Q5_MCL1-01      ----------------------------MCEEEEDELYWQSLEIISRYLR
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-01      TGYDNREIVMKYIHYKLSQRGYEW-------DAGDAGAAPPGAAPAPGIL
A0A4W2BWN1_BCL2-02      TGYDNREIVMKYIHYKLSQRGYEW-------DAGDAGAAPPGAAPAPGIL
A0A4W2GX13_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS---DVEENRTEAPEGTESDMET
A0A4W2D608_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS---GMKEHRTETPEGRESDMET
A0A4W2F845_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLAD---
A0A4W2D770_MCL1-02      ---MFGLKRNAVIGLNLYCGGAGLGQGS--------------GASSPGGR
A0A4W2EB77_BCL2L10      FRERTARLLMDYLEFCAREPGTPAPAPS----------------------
A0A4W2C0F3_BCL2L10      FRERTARLLMDYLEFCAREPGTPVPAPS----------------------
A0A4W2FG99_BCL2L10      FRERTARLLMDYLEFCAREPGTPAPAPS----------------------
A0A4W2D770_MCL1-01      AVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLR
A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGP----------------------
A0A4W2D6A3_BCL2L2-      -----------------------VEGDP----------------------
A0A4W2GUJ7_BCL2L2-      -----------------------VEGDP----------------------
                                                                          

A0A4W2CQV1_MCL1-01      EQATGAKDVKPLGRSGATSRKALET-----------------LHRVGDGV
A0A4W2G6Q5_MCL1-01      EQATGAKDVKPLGGSGATSRKALET-----------------LHRVGDGV
A0A4W2DYC0_BCL2A1-      -----MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQ
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-01      SSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLT-----LRQAGDDF
A0A4W2BWN1_BCL2-02      SSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLT-----LRQAGDDF
A0A4W2GX13_BCL2L1-      PSAINGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEF
A0A4W2D608_BCL2L1-      P------------NSPTVNGATGHSRSLDARKMIPMTTVKQALREASNEF
A0A4W2F845_BCL2L1-      --------------SPTVNGATGHSRSLDARKMIPMTTVKQALREASNEF
A0A4W2D770_MCL1-02      LLATGAKDAKPLGGSGTTSRKALET-----------------LRRVGDGV
A0A4W2EB77_BCL2L10      -------------------TPEAAV-----------------LRHVAARI
A0A4W2C0F3_BCL2L10      -------------------TPEAAV-----------------LRHVAARI
A0A4W2FG99_BCL2L10      -------------------TPEAAV-----------------LRHVAARI
A0A4W2D770_MCL1-01      EQATGAKDAKPLGGSGTTSRKALET-----------------LRRVGDGV
A0A4W2D6A3_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2D6A3_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2GUJ7_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2GUJ7_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2GUJ7_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2D6A3_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2GUJ7_BCL2L2-      -------------GEGPAADPLHQA-----------------MRAAGDEF
A0A4W2GUJ7_BCL2L2-      -------------GEGPAADP-----------------------------
A0A4W2D6A3_BCL2L2-      -------------GDGAIEDP-----------------------------
A0A4W2GUJ7_BCL2L2-      -------------GDGAIEDP-----------------------------
                                                                          

A0A4W2CQV1_MCL1-01      QHNHETAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISF
A0A4W2G6Q5_MCL1-01      QHNHETAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISF
A0A4W2DYC0_BCL2A1-      DEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAF
A0A4W2DYC0_BCL2A1-      ----------------------------------------MAAAVAVSGA
A0A4W2DYC0_BCL2A1-      -----------------------------MEKEFEDGIVNWGRIVTIFAF
A0A4W2BWN1_BCL2-01      SRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEF
A0A4W2BWN1_BCL2-02      SRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEF
A0A4W2GX13_BCL2L1-      ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSF
A0A4W2D608_BCL2L1-      KLWYQQTFSDLTSQLRITPGTACQSFEQVINELFRDR-VKWGHVVAFFSF
A0A4W2F845_BCL2L1-      KLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDR-VKWGHVVAFFSF
A0A4W2D770_MCL1-02      QRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISF
A0A4W2EB77_BCL2L10      QEANRNVLPLYRRCRRHRVELVARMAQRLLDE--DPG-PSWGRVASLVTF
A0A4W2C0F3_BCL2L10      QEANRNVLPLYRRCRRHRVELVARMAQRLLDE--DPG-PSWGRVASLVTF
A0A4W2FG99_BCL2L10      QEANRNVLPLYRRCRRHRVELVARMAQRLLDE--DPG-PSWGRVASLVTF
A0A4W2D770_MCL1-01      QRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISF
A0A4W2D6A3_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2D6A3_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2GUJ7_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2GUJ7_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2GUJ7_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2D6A3_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2GUJ7_BCL2L2-      ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVF
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2CQV1_MCL1-01      GAFVAK----------HFKSINQES---CIEPLAESITDVLVRSKRDWIV
A0A4W2G6Q5_MCL1-01      GAFVAK----------HFKSINQES---CIEPLAESITDVLVRSKRDWIV
A0A4W2DYC0_BCL2A1-      EGILTK----------KLLGKCIASDMDMCKDISFFVAEFITENTGEWIK
A0A4W2DYC0_BCL2A1-      KRSLRA----------ELKQRLRALSAEERLRQSHLLAQ-----------
A0A4W2DYC0_BCL2A1-      EGILTK----------KLLGKCIASDMDMCKDISFFVAEFITENTGEWIK
A0A4W2BWN1_BCL2-01      GGVMCV----------ESVNREMSP---LVDSIALWMTEYLNRHLHTWIQ
A0A4W2BWN1_BCL2-02      GGVMCV----------DDRVPEPAP-----------------AHLDPGQR
A0A4W2GX13_BCL2L1-      GGALCV----------ESVDKEMQV---LVSRIATWMATYLNDHLEPWIQ
A0A4W2D608_BCL2L1-      SGTICM----------KSIDKEIHV---LVSQVTTSMATYLNNHLKPWIQ
A0A4W2F845_BCL2L1-      SGTLCM----------KSIDKEIHV---LVSQVTTSTATYLNNHLKPWIQ
A0A4W2D770_MCL1-02      GAFVAK----------HLKSINQES---CIEPLAESITDVLVRSKRDWIV
A0A4W2EB77_BCL2L10      AGSLLERPPQTTRRQEKRDDDGVSR---DCRLLVALLCAQFCERHRAWLM
A0A4W2C0F3_BCL2L10      AGSLLERPPQTTRRQ-KRDDDGVSR---DCRLLVALLCAQFCERHRAWLM
A0A4W2FG99_BCL2L10      AGSLLERPPQTTRRQ-KRDDDGVSR---DCRLLVALLCAQFCERHRAWLM
A0A4W2D770_MCL1-01      GAFVAK----------HLKSINQES---CIEPLAESITDVLVRSKRDWIV
A0A4W2D6A3_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2D6A3_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      GAALCA----------ESVNKEMEP---LVGQVQEWMVAYLETRLADWIH
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2CQV1_MCL1-01      KERGW---------------------------------------------
A0A4W2G6Q5_MCL1-01      KERGW---------------------------------------------
A0A4W2DYC0_BCL2A1-      QNGGW------------------------------------ENGFVKKFE
A0A4W2DYC0_BCL2A1-      ----KVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQ
A0A4W2DYC0_BCL2A1-      QNGGWVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQ
A0A4W2BWN1_BCL2-01      DNGGW-------------------------------------DAFVELYG
A0A4W2BWN1_BCL2-02      RLGRC-------------------------------------SSGCESER
A0A4W2GX13_BCL2L1-      ENGGW-------------------------------------DTFVELYG
A0A4W2D608_BCL2L1-      ENGGW-------------------------------------DTFVELYE
A0A4W2F845_BCL2L1-      ENGGW-------------------------------------DTFVELYE
A0A4W2D770_MCL1-02      KQRGW---------------------------------------------
A0A4W2EB77_BCL2L10      TNGGW---------------------------------------------
A0A4W2C0F3_BCL2L10      ANGGW---------------------------------------------
A0A4W2FG99_BCL2L10      ANGGW---------------------------------------------
A0A4W2D770_MCL1-01      KQRGW---------------------------------------------
A0A4W2D6A3_BCL2L2-      SSGGW---------------------------------------------
A0A4W2D6A3_BCL2L2-      SSGGW---------------------------------------------
A0A4W2GUJ7_BCL2L2-      SSGGW---------------------------------------------
A0A4W2GUJ7_BCL2L2-      SSGGWFSQTSEAEMVHEVFFGEILSNCDSAPSSPVPEELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2D6A3_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      SSGGW--------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      -------------------------------------LHQAMRAAGDEFE
A0A4W2D6A3_BCL2L2-      -------------------------------------ELEAIKARVREME
A0A4W2GUJ7_BCL2L2-      -------------------------------------ELEAIKARVREME
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      TKSGWLTFLEVTG-------------------------------------
A0A4W2DYC0_BCL2A1-      LQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFV
A0A4W2DYC0_BCL2A1-      LQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFV
A0A4W2BWN1_BCL2-01      PSM-------RPLFDFSWLSLKALLSLALVGA-----------CITLGAY
A0A4W2BWN1_BCL2-02      DTS-------VPVRSEWW----GVAGPRVKGR-----------PVE----
A0A4W2GX13_BCL2L1-      NNAAAESRKGQERFNRWFLTGMTVAGVVLLGS--LFSRK-----------
A0A4W2D608_BCL2L1-      SNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHS
A0A4W2F845_BCL2L1-      SNTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRCPYYVGHS
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A4W2GUJ7_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A4W2D6A3_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A4W2GUJ7_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A4W2GUJ7_BCL2L2-      ---TRFRRTFSDLAAQLHVTPG---------SAQQRFTQVSDELFQGGPN
A0A4W2D6A3_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
A0A4W2GUJ7_BCL2L2-      EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
                                                                          

A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      ------KICETLCRLKQYY-------------------------------
A0A4W2DYC0_BCL2A1-      PGLGFDKQSNRLGRGKGYYDAYL---------------------------
A0A4W2DYC0_BCL2A1-      PGLGFDKQSNRLGRGKGYYDAYL---------------------------
A0A4W2BWN1_BCL2-01      LGHK----------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      GSDR----------------------------------------------
A0A4W2F845_BCL2L1-      GSDR----------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------DGF----VEFFHVEDL--
A0A4W2D6A3_BCL2L2-      --------------------------------AEF---------------
A0A4W2D6A3_BCL2L2-      --------------------------------AEF---------------
A0A4W2GUJ7_BCL2L2-      --------------------------------AEF---------------
A0A4W2GUJ7_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
A0A4W2GUJ7_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
A0A4W2D6A3_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
A0A4W2GUJ7_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
A0A4W2GUJ7_BCL2L2-      WGRLVAFF--VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS
A0A4W2D6A3_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
A0A4W2GUJ7_BCL2L2-      YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRT
                                                                          

A0A4W2CQV1_MCL1-01      ------------------------------DGFVEFFHVEDLEGGIRNVL
A0A4W2G6Q5_MCL1-01      ------------------------------DGFVEFFHVEDLEGGIRNVL
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      ---------------------------------------KRCLQSQDVKP
A0A4W2DYC0_BCL2A1-      ---------------------------------------KRCLQSQDVKP
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2D770_MCL1-02      ------------------------------DGFVEFFHVEDLEGGIRNVL
A0A4W2EB77_BCL2L10      ------------------------------DGFCLFFP-L-IPPSWERQL
A0A4W2C0F3_BCL2L10      ------------------------------DGFCLFFS-QSFQPSWERQL
A0A4W2FG99_BCL2L10      ------------------------------DGFCLFFS-QSFQPSWERQL
A0A4W2D770_MCL1-01      ------------------------------------------EGGIRNVL
A0A4W2D6A3_BCL2L2-      -------------------------TALYGDGALEEAR-RLREGNWASVR
A0A4W2D6A3_BCL2L2-      -------------------------TALYGDGALEEAR-RLREGNWASVR
A0A4W2GUJ7_BCL2L2-      -------------------------TALYGDGALEEAR-RLREGNWASVR
A0A4W2GUJ7_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
A0A4W2GUJ7_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
A0A4W2D6A3_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
A0A4W2GUJ7_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
A0A4W2GUJ7_BCL2L2-      SGGWAEF------------------TALYGDGALEEAR-RLREGNWASVR
A0A4W2D6A3_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
A0A4W2GUJ7_BCL2L2-      SLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY-RARTTNYNSSR
                                                                          

A0A4W2CQV1_MCL1-01      LAFAGVAGVGA----GLAYLIR----------
A0A4W2G6Q5_MCL1-01      LAFAGVAGVGA----GLAYLIR----------
A0A4W2DYC0_BCL2A1-      --------------------------------
A0A4W2DYC0_BCL2A1-      YTLALAFKEQICLQVPVNENDVKVDEVLYEDS
A0A4W2DYC0_BCL2A1-      YTLALAFKEQICLQVPVNENDVKVDEVLYEDS
A0A4W2BWN1_BCL2-01      --------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------
A0A4W2D608_BCL2L1-      --------------------------------
A0A4W2F845_BCL2L1-      --------------------------------
A0A4W2D770_MCL1-02      LAFAGVAGVGA----GLAYLIR----------
A0A4W2EB77_BCL2L10      VWFF-----------LSYWTAIIIIYFWIKLS
A0A4W2C0F3_BCL2L10      VWFF-----------LAYWTAIIIIYFWIKLL
A0A4W2FG99_BCL2L10      VWFF-----------LAYWTAIIIIYFWIKLL
A0A4W2D770_MCL1-01      LAFAGVAGVGA----GLAYLIR----------
A0A4W2D6A3_BCL2L2-      TVLTGAVALGALVTVGAFFASK----------
A0A4W2D6A3_BCL2L2-      TVLTGAVALGALVTVGAFFASK----------
A0A4W2GUJ7_BCL2L2-      TVLTGAVALGALVTVGAFFASK----------
A0A4W2GUJ7_BCL2L2-      SRFYSGFNSRPR---GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      SRFYSGFNSRPR---GRVYRSG----------
A0A4W2D6A3_BCL2L2-      SRFYSGFNSRPR---GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      SRFYSGFNSRPR---GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      TVLTGAVALGALVTVGAFFASK----------
A0A4W2D6A3_BCL2L2-      SRFYSGFNSRPR---GRVYRSG----------
A0A4W2GUJ7_BCL2L2-      SRFYSGFNSRPR---GRVYRSG----------
                                                        

© 1998-2020Legal notice