Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVR
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      SPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHHPA
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      ------------------------------------------MEKEFEDG
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      ------------------------------------------MAHAGGTG
A0A4W2BWN1_BCL2-01      ------------------------------------------MAHAGGTG
A0A4W2GX13_BCL2L1-      ------------------------------------------------MS
A0A4W2D608_BCL2L1-      ------------------------------------------------MS
A0A4W2F845_BCL2L1-      ------------------------------------------------MS
A0A4W2CQV1_MCL1-01      --------------------------------------------MCEEEE
A0A4W2G6Q5_MCL1-01      --------------------------------------------MCEEEE
A0A4W2DYC0_BCL2A1-      --------------------------------------------MTDTEF
A0A4W2D770_MCL1-02      ---------------------MFGLKRNAVIGLNLYCGGAGLGQGSGASS
A0A4W2D770_MCL1-01      ---------------------MFGLKRNAVIGLNLYCGGAGLGQGSGASS
A0A4W2EB77_BCL2L10      --------------------------------------------MVDPFR
A0A4W2C0F3_BCL2L10      -------------------------------------SADSLHSMVDPFR
A0A4W2FG99_BCL2L10      -------------------------------------SADSLHSMVDPFR
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      PGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
                                                                          

A0A4W2DYC0_BCL2A1-      IVNWGRIVTIFAFEGIL---------------------------------
A0A4W2DYC0_BCL2A1-      ---MAAAVAVSGAKRSL---------------------------------
A0A4W2BWN1_BCL2-02      YDNREIVMKYIHYKLSQ---------------------------------
A0A4W2BWN1_BCL2-01      YDNREIVMKYIHYKLSQ---------------------------------
A0A4W2GX13_BCL2L1-      QSNRELVVDFLSYKLSQ---------------------------------
A0A4W2D608_BCL2L1-      QSNRELVVDFLSYKLSQ---------------------------------
A0A4W2F845_BCL2L1-      QSNRELVVDFLSYKLSQ---------------------------------
A0A4W2CQV1_MCL1-01      DELYWQSLEIISRYLRE---------------------------------
A0A4W2G6Q5_MCL1-01      DELYWQSLEIISRYLRE---------------------------------
A0A4W2DYC0_BCL2A1-      GYVHGLAEDYLKYVLQI---------------------------------
A0A4W2D770_MCL1-02      PGGRLL--------------------------------------------
A0A4W2D770_MCL1-01      PGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPS
A0A4W2EB77_BCL2L10      ERTARLLMDYLEFCARE---------------------------------
A0A4W2C0F3_BCL2L10      ERTARLLMDYLEFCARE---------------------------------
A0A4W2FG99_BCL2L10      ERTARLLMDYLEFCARE---------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2D6A3_BCL2L2-      AAAAGAAGGRGSGPGRR---------------------------------
A0A4W2GUJ7_BCL2L2-      AAAAGAAGGRGSGPGRR---------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQ---------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      PIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCE
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      PDPLGKRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSL
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      ----------TKKLL-------GKCIASDMDMCKDISFFVAEFITENTGE
A0A4W2DYC0_BCL2A1-      ----------RAELK-------QRLRALSAEERLRQSHLLAQ--------
A0A4W2BWN1_BCL2-02      ----------RGYEW-------DAGDAGAAPPGAAPAPGILSSQPGRTPA
A0A4W2BWN1_BCL2-01      ----------RGYEW-------DAGDAGAAPPGAAPAPGILSSQPGRTPA
A0A4W2GX13_BCL2L1-      ----------KGYSWSQFS---DVEENRTEAPEGTESDMETPSAINGNAS
A0A4W2D608_BCL2L1-      ----------KGYSWSQFS---GMKEHRTETPEGRESDMETP--------
A0A4W2F845_BCL2L1-      ----------KGYSWSQFSVRYGNPQWISGNPSWHLAD------------
A0A4W2CQV1_MCL1-01      ---------QATGAK-------DVKPLGRSGATS----------------
A0A4W2G6Q5_MCL1-01      ---------QATGAK-------DVKPLGGSGATS----------------
A0A4W2DYC0_BCL2A1-      ---------------------------QQPGSKP----------------
A0A4W2D770_MCL1-02      ----------ATGAK-------DAKPLGGSGTTS----------------
A0A4W2D770_MCL1-01      EIISQYLREQATGAK-------DAKPLGGSGTTS----------------
A0A4W2EB77_BCL2L10      ----------PGTPA-------PA---PSTPEAA----------------
A0A4W2C0F3_BCL2L10      ----------PGTPV-------PA---PSTPEAA----------------
A0A4W2FG99_BCL2L10      ----------PGTPA-------PA---PSTPEAA----------------
A0A4W2D6A3_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2D6A3_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2GUJ7_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2GUJ7_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2D6A3_BCL2L2-      ----------RHLVP-------GAGGEAGEGAPG----------------
A0A4W2GUJ7_BCL2L2-      ----------RHLVP-------GAGGEAGEGAPG----------------
A0A4W2GUJ7_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2D6A3_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2GUJ7_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
A0A4W2GUJ7_BCL2L2-      ----------KGYVC-------GAG--PGEGPAA----------------
                                                                          

A0A4W2DYC0_BCL2A1-      WIKQNGGWVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTC---
A0A4W2DYC0_BCL2A1-      -------KVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTC---
A0A4W2BWN1_BCL2-02      PSRTSPPPPPAAAAGPAPSPVPPVVHL-------T-----LRQAGDD---
A0A4W2BWN1_BCL2-01      PSRTSPPPPPAAAAGPAPSPVPPVVHL-------T-----LRQAGDD---
A0A4W2GX13_BCL2L1-      WHLADSPAVNGATGHSRSSDAREVIPM-------AAVKQALREAGDE---
A0A4W2D608_BCL2L1-      ----NSPTVNGATGHSRSLDARKMIPM-------TTVKQALREASNE---
A0A4W2F845_BCL2L1-      -----SPTVNGATGHSRSLDARKMIPM-------TTVKQALREASNE---
A0A4W2CQV1_MCL1-01      ----------------------------------RKALETLHRVGDG---
A0A4W2G6Q5_MCL1-01      ----------------------------------RKALETLHRVGDG---
A0A4W2DYC0_BCL2A1-      ----------------------------------SKTSRVLQDVASS---
A0A4W2D770_MCL1-02      ----------------------------------RKALETLRRVGDG---
A0A4W2D770_MCL1-01      ----------------------------------RKALETLRRVGDG---
A0A4W2EB77_BCL2L10      ----------------------------------VLRHVAARIQEANRNV
A0A4W2C0F3_BCL2L10      ----------------------------------VLRHVAARIQEANRNV
A0A4W2FG99_BCL2L10      ----------------------------------VLRHVAARIQEANRNV
A0A4W2D6A3_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2D6A3_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2D6A3_BCL2L2-      ----------------------------------GAGDYGNGLESEE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------GAGDYGNGLESEE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2D6A3_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
A0A4W2GUJ7_BCL2L2-      ----------------------------------DPLHQAMRAAGDE---
                                                                          

A0A4W2DYC0_BCL2A1-      --FIPRYQLQSNHMDMVKLASPEEIALLPRTSWNI-QQPGEDEVLEEA-L
A0A4W2DYC0_BCL2A1-      --FIPRYQLQSNHMDMVKLASPEEIALLPRTSWNI-QQPGEDEVLEEA-L
A0A4W2BWN1_BCL2-02      --FSRRYRRDFAEM-------SSQLHLTPFTARGR-FATVVEELFRDG-V
A0A4W2BWN1_BCL2-01      --FSRRYRRDFAEM-------SSQLHLTPFTARGR-FATVVEELFRDG-V
A0A4W2GX13_BCL2L1-      --FELRYRRAFSDL-------TSQLHITPGTAYQS-FEQVVNELFRDG-V
A0A4W2D608_BCL2L1-      --FKLWYQQTFSDL-------TSQLRITPGTACQS-FEQVINELFRDR-V
A0A4W2F845_BCL2L1-      --FKLRYQQTFSDL-------MSQLRITPGTACQS-FEQVINELFRDR-V
A0A4W2CQV1_MCL1-01      --VQHNHETAFQGM-------LQKLDIKNEDDVKS-LSRVMVHVFSDRVT
A0A4W2G6Q5_MCL1-01      --VQHNHETAFQGM-------LQKLDIKNEDDVKS-LSRVMVHVFSDRVT
A0A4W2DYC0_BCL2A1-      --VQDEVERTLKQC-------LDKFDVVSVDTARTIFNQVMEKEFEDGIV
A0A4W2D770_MCL1-02      --VQRNHETAFQGM-------LRKLDIKNEDDVKS-LSRVMVHVFSDGVT
A0A4W2D770_MCL1-01      --VQRNHETAFQGM-------LRKLDIKNEDDVKS-LSRVMVHVFSDGVT
A0A4W2EB77_BCL2L10      LPLYRRCRRHRVEL-------VARM-------AQR-LLDEDP-----G-P
A0A4W2C0F3_BCL2L10      LPLYRRCRRHRVEL-------VARM-------AQR-LLDEDP-----G-P
A0A4W2FG99_BCL2L10      LPLYRRCRRHRVEL-------VARM-------AQR-LLDEDP-----G-P
A0A4W2D6A3_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2D6A3_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2GUJ7_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2GUJ7_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2D6A3_BCL2L2-      --LEP------EEL-------LLEPEPEPEPEEEP-PRPRAP---PGA-P
A0A4W2GUJ7_BCL2L2-      --LEP------EEL-------LLEPEPEPEPEEEP-PRPRAP---PGA-P
A0A4W2GUJ7_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2D6A3_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2GUJ7_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
A0A4W2GUJ7_BCL2L2-      --FETRFRRTFSDL-------AAQLHVTPGSAQQR-FTQVSDELFQGG-P
                          .                                               

A0A4W2DYC0_BCL2A1-      STGGLDLIFVPG--------------------------------------
A0A4W2DYC0_BCL2A1-      STGGLDLIFVPG--------------------------------------
A0A4W2BWN1_BCL2-02      NWGRIVAFFEFGGVMCV--------------DDRVPE--PAP--------
A0A4W2BWN1_BCL2-01      NWGRIVAFFEFGGVMCV--------------ESVNRE--MSPLV------
A0A4W2GX13_BCL2L1-      NWGRIVAFFSFGGALCV--------------ESVDKE--MQVLV------
A0A4W2D608_BCL2L1-      KWGHVVAFFSFSGTICM--------------KSIDKE--IHVLV------
A0A4W2F845_BCL2L1-      KWGHVVAFFSFSGTLCM--------------KSIDKE--IHVLV------
A0A4W2CQV1_MCL1-01      NWGRIVTLISFGAFVAKHF------------KSINQESCIEPLA------
A0A4W2G6Q5_MCL1-01      NWGRIVTLISFGAFVAKHF------------KSINQESCIEPLA------
A0A4W2DYC0_BCL2A1-      NWGRIVTIFAFEGILTKKLLG----------KCIASD--MDMCK------
A0A4W2D770_MCL1-02      NWGRIVTLISFGAFVAKHL------------KSINQESCIEPLA------
A0A4W2D770_MCL1-01      NWGRIVTLISFGAFVAKHL------------KSINQESCIEPLA------
A0A4W2EB77_BCL2L10      SWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRD--CRLLV------
A0A4W2C0F3_BCL2L10      SWGRVASLVTFAGSLLERPPQTTRRQ-KRDDDGVSRD--CRLLV------
A0A4W2FG99_BCL2L10      SWGRVASLVTFAGSLLERPPQTTRRQ-KRDDDGVSRD--CRLLV------
A0A4W2D6A3_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2D6A3_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2GUJ7_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2GUJ7_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2D6A3_BCL2L2-      GPGP-------GSGAPG--------------NQEEEE--ESGLVEGDPGD
A0A4W2GUJ7_BCL2L2-      GPGP-------GSGAPG--------------NQEEEE--ESGLVEGDPGD
A0A4W2GUJ7_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2D6A3_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2GUJ7_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
A0A4W2GUJ7_BCL2L2-      NWGRLVAFFVFGAALCA--------------ESVNKE--MEPLV------
                          *                                               

A0A4W2DYC0_BCL2A1-      --------LGFDKQSNRLGRGKGYYD------------------------
A0A4W2DYC0_BCL2A1-      --------LGFDKQSNRLGRGKGYYD------------------------
A0A4W2BWN1_BCL2-02      ------------AHLDPGQRRLGRCS------------------------
A0A4W2BWN1_BCL2-01      DSIALWMTEYLNRHLHTWIQDNGGWD------------------------
A0A4W2GX13_BCL2L1-      SRIATWMATYLNDHLEPWIQENGGWD------------------------
A0A4W2D608_BCL2L1-      SQVTTSMATYLNNHLKPWIQENGGWD------------------------
A0A4W2F845_BCL2L1-      SQVTTSTATYLNNHLKPWIQENGGWD------------------------
A0A4W2CQV1_MCL1-01      ----ESITDVLVRSKRDWIVKERGWD------------------------
A0A4W2G6Q5_MCL1-01      ----ESITDVLVRSKRDWIVKERGWD------------------------
A0A4W2DYC0_BCL2A1-      -DISFFVAEFITENTGEWIKQNGGWE------------------------
A0A4W2D770_MCL1-02      ----ESITDVLVRSKRDWIVKQRGWD------------------------
A0A4W2D770_MCL1-01      ----ESITDVLVRSKRDWIVKQRGWD------------------------
A0A4W2EB77_BCL2L10      ----ALLCAQFCERHRAWLMTNGGWD------------------------
A0A4W2C0F3_BCL2L10      ----ALLCAQFCERHRAWLMANGGWD------------------------
A0A4W2FG99_BCL2L10      ----ALLCAQFCERHRAWLMANGGWD------------------------
A0A4W2D6A3_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWA------------------------
A0A4W2D6A3_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWA------------------------
A0A4W2GUJ7_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWA------------------------
A0A4W2GUJ7_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWA------------------------
A0A4W2D6A3_BCL2L2-      GAIEDP--------------------------------------------
A0A4W2GUJ7_BCL2L2-      GAIEDP--------------------------------------------
A0A4W2GUJ7_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEMVHEVFFGEILSNCDSA
A0A4W2D6A3_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGW-------------------------
A0A4W2GUJ7_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGW-------------------------
A0A4W2GUJ7_BCL2L2-      GQVQEWMVAYLETRLADWIHSSGGW-------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      -------EFTALYG--DGALEEARRLRE---------------GNWASV-
A0A4W2D6A3_BCL2L2-      -------EFTALYG--DGALEEARRLRE---------------GNWASV-
A0A4W2GUJ7_BCL2L2-      -------EFTALYG--DGALEEARRLRE---------------GNWASV-
A0A4W2GUJ7_BCL2L2-      -------EFTALYG--DGALEEARRLRE---------------GNWASV-
A0A4W2D6A3_BCL2L2-      -------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
A0A4W2GUJ7_BCL2L2-      -------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
A0A4W2GUJ7_BCL2L2-      PSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
A0A4W2D6A3_BCL2L2-      -------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
A0A4W2GUJ7_BCL2L2-      -------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
A0A4W2GUJ7_BCL2L2-      -------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A4W2D6A3_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A4W2GUJ7_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A4W2GUJ7_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A4W2D6A3_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A4W2GUJ7_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A4W2GUJ7_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A4W2D6A3_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A4W2GUJ7_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A4W2GUJ7_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
                                                                          

A0A4W2DYC0_BCL2A1-      -------------------------------------------------A
A0A4W2DYC0_BCL2A1-      -------------------------------------------------A
A0A4W2BWN1_BCL2-02      -------------------------------------------------S
A0A4W2BWN1_BCL2-01      -------------------------------------------------A
A0A4W2GX13_BCL2L1-      -------------------------------------------------T
A0A4W2D608_BCL2L1-      -------------------------------------------------T
A0A4W2F845_BCL2L1-      -------------------------------------------------T
A0A4W2CQV1_MCL1-01      -------------------------------------------------G
A0A4W2G6Q5_MCL1-01      -------------------------------------------------G
A0A4W2DYC0_BCL2A1-      ------------------------------------------------NG
A0A4W2D770_MCL1-02      -------------------------------------------------G
A0A4W2D770_MCL1-01      -------------------------------------------------G
A0A4W2EB77_BCL2L10      -------------------------------------------------G
A0A4W2C0F3_BCL2L10      -------------------------------------------------G
A0A4W2FG99_BCL2L10      -------------------------------------------------G
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A4W2GUJ7_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A4W2GUJ7_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A4W2D6A3_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A4W2GUJ7_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A4W2GUJ7_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
                                                                          

A0A4W2DYC0_BCL2A1-      YLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS-----
A0A4W2DYC0_BCL2A1-      YLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS-----
A0A4W2BWN1_BCL2-02      GCESERDTS-------VPVRSEWW----GVAGPRVKGR-----------P
A0A4W2BWN1_BCL2-01      FVELYGPSM-------RPLFDFSWLSLKALLSLALVGA-----------C
A0A4W2GX13_BCL2L1-      FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGS--LFSRK-----
A0A4W2D608_BCL2L1-      FVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCP
A0A4W2F845_BCL2L1-      FVELYESNTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRCP
A0A4W2CQV1_MCL1-01      FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------------
A0A4W2G6Q5_MCL1-01      FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------------
A0A4W2DYC0_BCL2A1-      FVKKFET-------KSGWLTFLEVTGKICETLCRLKQYY-----------
A0A4W2D770_MCL1-02      FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------------
A0A4W2D770_MCL1-01      FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------------
A0A4W2EB77_BCL2L10      FCLFFPL-IPPSWERQLVWFFLSYWTAIIIIYFWIKLS------------
A0A4W2C0F3_BCL2L10      FCLFFSQSFQPSWERQLVWFFLAYWTAIIIIYFWIKLL------------
A0A4W2FG99_BCL2L10      FCLFFSQSFQPSWERQLVWFFLAYWTAIIIIYFWIKLL------------
A0A4W2D6A3_BCL2L2-      -----------------------------GAFFASK--------------
A0A4W2D6A3_BCL2L2-      -----------------------------GAFFASK--------------
A0A4W2GUJ7_BCL2L2-      -----------------------------GAFFASK--------------
A0A4W2GUJ7_BCL2L2-      -----------------------------GAFFASK--------------
A0A4W2D6A3_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG--------------
A0A4W2GUJ7_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG--------------
A0A4W2GUJ7_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY----
A0A4W2D6A3_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY----
A0A4W2GUJ7_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY----
A0A4W2GUJ7_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG--------------
                                                                          

A0A4W2DYC0_BCL2A1-      ----------
A0A4W2DYC0_BCL2A1-      ----------
A0A4W2BWN1_BCL2-02      VE--------
A0A4W2BWN1_BCL2-01      ITLGAYLGHK
A0A4W2GX13_BCL2L1-      ----------
A0A4W2D608_BCL2L1-      YYVGHSGSDR
A0A4W2F845_BCL2L1-      YYVGHSGSDR
A0A4W2CQV1_MCL1-01      ----------
A0A4W2G6Q5_MCL1-01      ----------
A0A4W2DYC0_BCL2A1-      ----------
A0A4W2D770_MCL1-02      ----------
A0A4W2D770_MCL1-01      ----------
A0A4W2EB77_BCL2L10      ----------
A0A4W2C0F3_BCL2L10      ----------
A0A4W2FG99_BCL2L10      ----------
A0A4W2D6A3_BCL2L2-      ----------
A0A4W2D6A3_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
A0A4W2D6A3_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
A0A4W2D6A3_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
A0A4W2GUJ7_BCL2L2-      ----------
                                  

© 1998-2021Legal notice