Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
A0A4W2D770_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      ----------------MAAAAAAAAAAGAAGGRGS---------------
A0A4W2GUJ7_BCL2L2-      ----------------MAAAAAAAAAAGAAGGRGS---------------
A0A4W2GUJ7_BCL2L2-      ------------------MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNL
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --GPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPE
A0A4W2GUJ7_BCL2L2-      --GPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPE
A0A4W2GUJ7_BCL2L2-      LQGFMRPSRLLFTASRVRSPAWPLMPSWPCSSWPPAALFFPELWLFPSLR
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      PEPEEEPPRPRAPPGAPGPGPGSGAP--------------------GNQE
A0A4W2GUJ7_BCL2L2-      PEPEEEPPRPRAPPGAPGPGPGSGAP--------------------GNQE
A0A4W2GUJ7_BCL2L2-      PSPAPLSGRISGPHHHPAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQ
                                                                          

A0A4W2DYC0_BCL2A1-      ----------MEKEFEDGIVNWGRIVTIFAFEGILTKKLL-------GKC
A0A4W2DYC0_BCL2A1-      ---------------------MAAAVAVSGAKRSLRAELK-------QRL
A0A4W2BWN1_BCL2-02      ----------MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-------DAG
A0A4W2BWN1_BCL2-01      ----------MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-------DAG
A0A4W2GX13_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFS---DVE
A0A4W2D608_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFS---GMK
A0A4W2F845_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNP
A0A4W2CQV1_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQA-------TGA
A0A4W2G6Q5_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQA-------TGA
A0A4W2DYC0_BCL2A1-      ------------MTDTEFGYVHGLAEDYLKYVLQIQ--------------
A0A4W2D770_MCL1-02      ---------------------------------------A-------TGA
A0A4W2D770_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQA-------TGA
A0A4W2EB77_BCL2L10      ------------MVDPFRERTARLLMDYLEF--------C-------ARE
A0A4W2C0F3_BCL2L10      -----SADSLHSMVDPFRERTARLLMDYLEF--------C-------ARE
A0A4W2FG99_BCL2L10      -----SADSLHSMVDPFRERTARLLMDYLEF--------C-------ARE
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      EEEESGL--------------------------------V-------EGD
A0A4W2GUJ7_BCL2L2-      EEEESGL--------------------------------V-------EGD
A0A4W2GUJ7_BCL2L2-      PDPGSGLTPARMATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
                                                                          

A0A4W2DYC0_BCL2A1-      IASDMDMCKDISFFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFL
A0A4W2DYC0_BCL2A1-      RALSAEERLRQSHLLAQ---------------KVFTHNEYQKSKRVSIFL
A0A4W2BWN1_BCL2-02      DAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVV
A0A4W2BWN1_BCL2-01      DAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVV
A0A4W2GX13_BCL2L1-      ENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREVI
A0A4W2D608_BCL2L1-      EHRTETPEGRESDMETP------------NSPTVNGATGHSRSLDARKMI
A0A4W2F845_BCL2L1-      QWISGNPSWHLAD-----------------SPTVNGATGHSRSLDARKMI
A0A4W2CQV1_MCL1-01      KDVKPLGRSGATS-------------------------------------
A0A4W2G6Q5_MCL1-01      KDVKPLGGSGATS-------------------------------------
A0A4W2DYC0_BCL2A1-      -------QPGSKP-------------------------------------
A0A4W2D770_MCL1-02      KDAKPLGGSGTTS-------------------------------------
A0A4W2D770_MCL1-01      KDAKPLGGSGTTS-------------------------------------
A0A4W2EB77_BCL2L10      P------GTPAPA-------------------------------------
A0A4W2C0F3_BCL2L10      P------GTPVPA-------------------------------------
A0A4W2FG99_BCL2L10      P------GTPAPA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GDGAIE-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GDGAIE-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      SMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIALLP-
A0A4W2DYC0_BCL2A1-      SMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIALLP-
A0A4W2BWN1_BCL2-02      HL-------T-----LRQAGDDFSRRYRRDFAEM-------SSQLHLTP-
A0A4W2BWN1_BCL2-01      HL-------T-----LRQAGDDFSRRYRRDFAEM-------SSQLHLTP-
A0A4W2GX13_BCL2L1-      PM-------AAVKQALREAGDEFELRYRRAFSDL-------TSQLHITP-
A0A4W2D608_BCL2L1-      PM-------TTVKQALREASNEFKLWYQQTFSDL-------TSQLRITP-
A0A4W2F845_BCL2L1-      PM-------TTVKQALREASNEFKLRYQQTFSDL-------MSQLRITP-
A0A4W2CQV1_MCL1-01      ---------RKALETLHRVGDGVQHNHETAFQGM-------LQKLDIKN-
A0A4W2G6Q5_MCL1-01      ---------RKALETLHRVGDGVQHNHETAFQGM-------LQKLDIKN-
A0A4W2DYC0_BCL2A1-      ---------SKTSRVLQDVASSVQDEVERTLKQC-------LDKFDVVSV
A0A4W2D770_MCL1-02      ---------RKALETLRRVGDGVQRNHETAFQGM-------LRKLDIKN-
A0A4W2D770_MCL1-01      ---------RKALETLRRVGDGVQRNHETAFQGM-------LRKLDIKN-
A0A4W2EB77_BCL2L10      ---------PSTPEA--AVLRHVAARIQEANRNV-------LPLYRRCR-
A0A4W2C0F3_BCL2L10      ---------PSTPEA--AVLRHVAARIQEANRNV-------LPLYRRCR-
A0A4W2FG99_BCL2L10      ---------PSTPEA--AVLRHVAARIQEANRNV-------LPLYRRCR-
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDEFETRFRRTFSDL-------AAQLHVTP-
A0A4W2D6A3_BCL2L2-      ---------DP---------------------------------------
A0A4W2GUJ7_BCL2L2-      ---------DP---------------------------------------
A0A4W2GUJ7_BCL2L2-      ---------DP---------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      RTSWNIQQPGEDEVLEE--ALSTGGLDLIFVPG-----------------
A0A4W2DYC0_BCL2A1-      RTSWNIQQPGEDEVLEE--ALSTGGLDLIFVPG-----------------
A0A4W2BWN1_BCL2-02      FTARGRFATVVEELFRD--GVNWGRIVAFFEFGGVMCV----------DD
A0A4W2BWN1_BCL2-01      FTARGRFATVVEELFRD--GVNWGRIVAFFEFGGVMCV----------ES
A0A4W2GX13_BCL2L1-      GTAYQSFEQVVNELFRD--GVNWGRIVAFFSFGGALCV----------ES
A0A4W2D608_BCL2L1-      GTACQSFEQVINELFRD--RVKWGHVVAFFSFSGTICM----------KS
A0A4W2F845_BCL2L1-      GTACQSFEQVINELFRD--RVKWGHVVAFFSFSGTLCM----------KS
A0A4W2CQV1_MCL1-01      EDDVKSLSRVMVHVFSDR-VTNWGRIVTLISFGAFVAK----------HF
A0A4W2G6Q5_MCL1-01      EDDVKSLSRVMVHVFSDR-VTNWGRIVTLISFGAFVAK----------HF
A0A4W2DYC0_BCL2A1-      DTARTIFNQVMEKEFEDG-IVNWGRIVTIFAFEGILTKKLL-------GK
A0A4W2D770_MCL1-02      EDDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK----------HL
A0A4W2D770_MCL1-01      EDDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK----------HL
A0A4W2EB77_BCL2L10      RHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKR
A0A4W2C0F3_BCL2L10      RHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQ-KR
A0A4W2FG99_BCL2L10      RHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQ-KR
A0A4W2D6A3_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2D6A3_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2GUJ7_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2GUJ7_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2D6A3_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2GUJ7_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2GUJ7_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA----------ES
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      -----------------LGFDKQSNRLGRGKGYY----------------
A0A4W2DYC0_BCL2A1-      -----------------LGFDKQSNRLGRGKGYY----------------
A0A4W2BWN1_BCL2-02      RVPEPAP--------------AHLDPGQRRLGRC----------------
A0A4W2BWN1_BCL2-01      VNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGW----------------
A0A4W2GX13_BCL2L1-      VDKEMQVLVSRIATWMATYLNDHLEPWIQENGGW----------------
A0A4W2D608_BCL2L1-      IDKEIHVLVSQVTTSMATYLNNHLKPWIQENGGW----------------
A0A4W2F845_BCL2L1-      IDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGW----------------
A0A4W2CQV1_MCL1-01      KSINQESCIEPLAESITDVLVRSKRDWIVKERGW----------------
A0A4W2G6Q5_MCL1-01      KSINQESCIEPLAESITDVLVRSKRDWIVKERGW----------------
A0A4W2DYC0_BCL2A1-      CIASDMDMCKDISFFVAEFITENTGEWIKQNGGW----------------
A0A4W2D770_MCL1-02      KSINQESCIEPLAESITDVLVRSKRDWIVKQRGW----------------
A0A4W2D770_MCL1-01      KSINQESCIEPLAESITDVLVRSKRDWIVKQRGW----------------
A0A4W2EB77_BCL2L10      DDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGW----------------
A0A4W2C0F3_BCL2L10      DDDGVSRDCRLLVALLCAQFCERHRAWLMANGGW----------------
A0A4W2FG99_BCL2L10      DDDGVSRDCRLLVALLCAQFCERHRAWLMANGGW----------------
A0A4W2D6A3_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2D6A3_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2GUJ7_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2GUJ7_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEMVHEVFFG
A0A4W2D6A3_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2GUJ7_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2GUJ7_BCL2L2-      VNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      EILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2D6A3_BCL2L2-      ----------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2GUJ7_BCL2L2-      ----------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2GUJ7_BCL2L2-      ----------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2D6A3_BCL2L2-      ----------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2GUJ7_BCL2L2-      ----------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A4W2GUJ7_BCL2L2-      ----------------LHQAMRAAGDEFE---TRFRRTFSDLAAQLHVTP
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2D6A3_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2GUJ7_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2GUJ7_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2D6A3_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2GUJ7_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A4W2GUJ7_BCL2L2-      G---------SAQQRFTQVSDELFQGGPNWGRLVAFF--VFGAALCAESV
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      -----------AEF------------------------------------
A0A4W2D6A3_BCL2L2-      -----------AEF------------------------------------
A0A4W2GUJ7_BCL2L2-      -----------AEF------------------------------------
A0A4W2GUJ7_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2D6A3_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2GUJ7_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2GUJ7_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2D6A3_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2GUJ7_BCL2L2-      TILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKVIPKRT
A0A4W2GUJ7_BCL2L2-      NKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEF--------------
                                                                          

A0A4W2DYC0_BCL2A1-      ---------DAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDE
A0A4W2DYC0_BCL2A1-      ---------DAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDE
A0A4W2BWN1_BCL2-02      ---------SSGCESERDTS-------VPVRSEWW----GVAGPRVKGR-
A0A4W2BWN1_BCL2-01      ---------DAFVELYGPSM-------RPLFDFSWLSLKALLSLALVGA-
A0A4W2GX13_BCL2L1-      ---------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGS-
A0A4W2D608_BCL2L1-      ---------DTFVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNT
A0A4W2F845_BCL2L1-      ---------DTFVELYESNTTNESQKGQECFNSIYTTAAVAGLTNLISNT
A0A4W2CQV1_MCL1-01      ---------DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA---GLAYLIR
A0A4W2G6Q5_MCL1-01      ---------DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA---GLAYLIR
A0A4W2DYC0_BCL2A1-      --------ENGFVKKFET--KSGWLTFLEVT------------GKICETL
A0A4W2D770_MCL1-02      ---------DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA---GLAYLIR
A0A4W2D770_MCL1-01      ---------DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA---GLAYLIR
A0A4W2EB77_BCL2L10      ---------DGFCLFFPL-IPPSWERQLVWFF-----------LSYWTAI
A0A4W2C0F3_BCL2L10      ---------DGFCLFFSQSFQPSWERQLVWFF-----------LAYWTAI
A0A4W2FG99_BCL2L10      ---------DGFCLFFSQSFQPSWERQLVWFF-----------LAYWTAI
A0A4W2D6A3_BCL2L2-      ----TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A4W2D6A3_BCL2L2-      ----TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A4W2GUJ7_BCL2L2-      ----TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A4W2GUJ7_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRGR
A0A4W2D6A3_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRGR
A0A4W2GUJ7_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRGR
A0A4W2GUJ7_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRSG
A0A4W2D6A3_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRSG
A0A4W2GUJ7_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GRVYRSG
A0A4W2GUJ7_BCL2L2-      ----TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                                                                          

A0A4W2DYC0_BCL2A1-      VLYEDS---------------
A0A4W2DYC0_BCL2A1-      VLYEDS---------------
A0A4W2BWN1_BCL2-02      ----------PVE--------
A0A4W2BWN1_BCL2-01      ----------CITLGAYLGHK
A0A4W2GX13_BCL2L1-      -LFSRK---------------
A0A4W2D608_BCL2L1-      KLYSKLDQRCPYYVGHSGSDR
A0A4W2F845_BCL2L1-      KLYSKLDQRCPYYVGHSGSDR
A0A4W2CQV1_MCL1-01      ---------------------
A0A4W2G6Q5_MCL1-01      ---------------------
A0A4W2DYC0_BCL2A1-      CRLKQYY--------------
A0A4W2D770_MCL1-02      ---------------------
A0A4W2D770_MCL1-01      ---------------------
A0A4W2EB77_BCL2L10      IIIYFWIKLS-----------
A0A4W2C0F3_BCL2L10      IIIYFWIKLL-----------
A0A4W2FG99_BCL2L10      IIIYFWIKLL-----------
A0A4W2D6A3_BCL2L2-      ---------------------
A0A4W2D6A3_BCL2L2-      ---------------------
A0A4W2GUJ7_BCL2L2-      ---------------------
A0A4W2GUJ7_BCL2L2-      ARATSWYSPY-----------
A0A4W2D6A3_BCL2L2-      ARATSWYSPY-----------
A0A4W2GUJ7_BCL2L2-      ARATSWYSPY-----------
A0A4W2GUJ7_BCL2L2-      ---------------------
A0A4W2D6A3_BCL2L2-      ---------------------
A0A4W2GUJ7_BCL2L2-      ---------------------
A0A4W2GUJ7_BCL2L2-      ---------------------
                                             

© 1998-2020Legal notice