Dataset for protein Bcl-xL of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2D608_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS---GMKEHRTETPEGRESDMET
A0A4W2F845_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLAD---
                        ****************************   *  :. : .*. . :*   

A0A4W2D608_BCL2L1-      PNSPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLWYQQTFSDLT
A0A4W2F845_BCL2L1-      --SPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLRYQQTFSDLM
                          **************************************.******** 

A0A4W2D608_BCL2L1-      SQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTICMKSIDKEI
A0A4W2F845_BCL2L1-      SQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEI
                        ****************************************:*********

A0A4W2D608_BCL2L1-      HVLVSQVTTSMATYLNNHLKPWIQENGGWDTFVELYESNTTNESQKGQER
A0A4W2F845_BCL2L1-      HVLVSQVTTSTATYLNNHLKPWIQENGGWDTFVELYESNTTNESQKGQEC
                        ********** ************************************** 

A0A4W2D608_BCL2L1-      FNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSGSDR
A0A4W2F845_BCL2L1-      FNSIYTTAAVAGLTNLISNTKLYSKLDQRCPYYVGHSGSDR
                        *************:***************************

© 1998-2023Legal notice