Dataset for protein Bcl-xL of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2GX13_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS---DVEENRTEAPEGTESDMET
A0A4W2D608_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS---GMKEHRTETPEGRESDMET
A0A4W2F845_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLAD---
                        ****************************   .  :. :  *.   :*   

A0A4W2GX13_BCL2L1-      PSAINGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEF
A0A4W2D608_BCL2L1-      P------------NSPTVNGATGHSRSLDARKMIPMTTVKQALREASNEF
A0A4W2F845_BCL2L1-      --------------SPTVNGATGHSRSLDARKMIPMTTVKQALREASNEF
                                      **:********** ***::***::********.:**

A0A4W2GX13_BCL2L1-      ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
A0A4W2D608_BCL2L1-      KLWYQQTFSDLTSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFS
A0A4W2F845_BCL2L1-      KLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFS
                        :*.*..:**** ***.****** ******:****** *:**.:******.

A0A4W2GX13_BCL2L1-      GALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGN
A0A4W2D608_BCL2L1-      GTICMKSIDKEIHVLVSQVTTSMATYLNNHLKPWIQENGGWDTFVELYES
A0A4W2F845_BCL2L1-      GTLCMKSIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGWDTFVELYES
                        *::*::*:***::****.::*  *****:**:**************** .

A0A4W2GX13_BCL2L1-      NAAAESRKGQERFNRWFLTGMTVAGVVLLGS--LFSRK------------
A0A4W2D608_BCL2L1-      NTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSG
A0A4W2F845_BCL2L1-      NTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRCPYYVGHSG
                        *:: **.**** **  : *. ... . *:..  *:*.             

A0A4W2GX13_BCL2L1-      ---
A0A4W2D608_BCL2L1-      SDR
A0A4W2F845_BCL2L1-      SDR
                           

© 1998-2020Legal notice