Dataset for protein Bcl-2 of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2BWN1_BCL2-02      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILS
A0A4W2BWN1_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILS
                        **************************************************

A0A4W2BWN1_BCL2-02      SQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRR
A0A4W2BWN1_BCL2-01      SQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRR
                        **************************************************

A0A4W2BWN1_BCL2-02      DFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVD
A0A4W2BWN1_BCL2-01      DFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
                        *************************************************:

A0A4W2BWN1_BCL2-02      DRVPEPAP--------------AHLDPGQRRLGRCSSGCESERDTSVPVR
A0A4W2BWN1_BCL2-01      SVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF
                        .   * :*               ** .  .  *  .:  *    :  *: 

A0A4W2BWN1_BCL2-02      SEWW----GVAGPRVKGRPVE--------
A0A4W2BWN1_BCL2-01      DFSWLSLKALLSLALVGACITLGAYLGHK
                        .  *    .: .  : *  :         

© 1998-2020Legal notice