Dataset for protein BCL-2-like of organism Anser cygnoid

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9E2U6_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAV
A0A8B9DB39_BCL2L1-      ------MSGSNRDLVIDFVSYKLSQKGYSWSQLEEEEDENRTDFAAEADT
A0A8B9E009_BCL2A1-      ---------------------------------METAEFYYVYYLAQDYL
A0A8B9EU67_MCL1-01      -----------------------------------------ALRSRRPPL
                                                                 .        

A0A8B9E2U6_BCL2-01      AAAGTPSRHRPAGLLSPHPEPPGSAAASEAPPGEGLRPAPPVVHLALRQA
A0A8B9DB39_BCL2L1-      DGVLNGSPSWHPPASQVVNGAAVHRSSLEVHEI----VRSAAVRQALREA
A0A8B9E009_BCL2A1-      QYVLQ-----------------------ESHLG----PAQTRVAHVLRNI
A0A8B9EU67_MCL1-01      AAVVEPRGGAGRLRTRNREGTRGGLDARDPPGA----ARRRKALETLRRV
                          .                         :             .  .**  

A0A8B9E2U6_BCL2-01      GDEFSRRYQRDFAQMSGQLHLTPFTARGRF-VAVVEELFRDGV-NWGRIV
A0A8B9DB39_BCL2L1-      GDEFELRYRRAFSDLTSQLHITPGTAYQSF-EQVVNELFRDGV-NWGRVV
A0A8B9E009_BCL2A1-      ASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFADGNTNWGRIM
A0A8B9EU67_MCL1-01      GDGVLEKHELAFQGMLRKLEIKKEEDLQSV-GEVAAHVFSDGVTNWGRVV
                        .. .  .    :  :  .: :.       .   *    * **  ****::

A0A8B9E2U6_BCL2-01      AFFEFGGVMCVESVNREMS---PLVDSIAAWMTEYLNRHLHNWIQDNGGW
A0A8B9DB39_BCL2L1-      AFFSFGGALCVESVDKEMR---VLVGRIVAWMTTYLTDHLDPWIQENGGW
A0A8B9E009_BCL2A1-      TIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGW
A0A8B9EU67_MCL1-01      TLISFGAFVAKHLKSIKQE---KCIGSLARIITDALVSSKREWLLSQGGW
                        ::: **. :     .            :   :*  :      *:  :***

A0A8B9E2U6_BCL2-01      VRALRFAFLLRWPTALGALGCLWGSRVPTCAHLSVSVGTRGLPAASFVPV
A0A8B9DB39_BCL2L1-      E-RFVDLYGNDAAAEVRKGQETFNKWLLTGATV-----------------
A0A8B9E009_BCL2A1-      ENGFLTKF------E--------RRSLLSFSKI-----------------
A0A8B9EU67_MCL1-01      E-GFVDFF------RVEDLEGSIRNVLMAFAGV-----------------
                           :   :                  : : : :                 

A0A8B9E2U6_BCL2-01      WAFCRLLCCRVSPDGGAAVKWCCFFLWRGAAAAPSSGAERPSKVSFPSES
A0A8B9DB39_BCL2L1-      ----------------AGVLLLGSLLSRK---------------------
A0A8B9E009_BCL2A1-      ----------------TDIFVALFSLFREYY-------------------
A0A8B9EU67_MCL1-01      ----------------AGLGASLAYMIR----------------------
                                        : :      : *                      

A0A8B9E2U6_BCL2-01      SAFPSPSPTGGISPGQGLFQRSMGRGCRGWGWAQGVAGPGCGDHVDIPAC
A0A8B9DB39_BCL2L1-      --------------------------------------------------
A0A8B9E009_BCL2A1-      --------------------------------------------------
A0A8B9EU67_MCL1-01      --------------------------------------------------
                                                                          

A0A8B9E2U6_BCL2-01      WGGAPGTASVGTWC
A0A8B9DB39_BCL2L1-      --------------
A0A8B9E009_BCL2A1-      --------------
A0A8B9EU67_MCL1-01      --------------
                                      

© 1998-2022Legal notice