Dataset for protein BAX-like of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5Q7S1_BAX-02       MDGSGEQPRGEGE------------AGGSRAE------------------
A0A2K5Q7S1_BAX-03       MDGSGEQPRGEGP------------TSSEQIMKTGALLLQGFIQDRAGRI
A0A2K5QZM8_BOK-01       ----MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLR-
A0A2K5SIP9_BAK1-01      ----MASGQGPGPPRQECGESDPPSASEAQVARDTEEVFHSYVFYRHQQ-
                                .  .             .                        

A0A2K5Q7S1_BAX-02       GGRAPELALDPVPQDASTK-KLSECLKRIGDELD---------SNMELQR
A0A2K5Q7S1_BAX-03       GGEAPELALDPVPQDASTK-KLSECLKRIGDELD---------SNMELQR
A0A2K5QZM8_BOK-01       AGLSWSAPERAAPVPGRLA-EVCAVLLRLGDELEMIRPSIYRNVAHQLHI
A0A2K5SIP9_BAK1-01      EQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRYDSEFQA
                           :   .  . *       : .  : .:* :*             ::: 

A0A2K5Q7S1_BAX-02       MIATVD--TNSPREVFFRVAADMFSDGNFNWGRVVAFFYFASKLVL---K
A0A2K5Q7S1_BAX-03       MIATVD--TNSPREVFFRVAADMFSDGNFNWGRVVAFFYFASKLVL---K
A0A2K5QZM8_BOK-01       SLQS-EPVVTDA---FLAVAGHIFSAG-ITWGKVVSLYAVAAGLAVDCVR
A0A2K5SIP9_BAK1-01      MLQHLQPTAENAYEYFTKIASSLFESG-INWGRVVALLGFGYRLALHVYQ
                         :   :  . ..   *  :*. :*. * :.**.**::  ..  *.:   .

A0A2K5Q7S1_BAX-02       VGSCRAVSPGIQTIISWGLSDSLLSYFGTP-TWQTVTIFVAGVLTASLTI
A0A2K5Q7S1_BAX-03       --------------------DSLLSYFGTP-TWQTVTIFVAGVLTASLTI
A0A2K5QZM8_BOK-01       QAQPAMVHALVDCLGEF-VRKTLATWLRRRGGWTDVLKCVVSTDPSLRSH
A0A2K5SIP9_BAK1-01      RGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL---GNGPILNV
                                              :  ::     *  .         .  . 

A0A2K5Q7S1_BAX-02       WKNMG-------------------
A0A2K5Q7S1_BAX-03       WKNMG-------------------
A0A2K5QZM8_BOK-01       WLLTALCSFGRFLKAAFFVLLPER
A0A2K5SIP9_BAK1-01      LVVLGVVLLGQFVVRRFFKS----
                            .                   

© 1998-2020Legal notice