Dataset for protein Bax of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5Q7S1_BAX-02      MDGSGEQPRGEGEAGGSRAE------------------GGRAPELALDPV
A0A2K5Q7S1_BAX-03      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGEAPELALDPV
                       ************ :....                    ** *********

A0A2K5Q7S1_BAX-02      PQDASTKKLSECLKRIGDELDSNMELQRMIATVDTNSPREVFFRVAADMF
A0A2K5Q7S1_BAX-03      PQDASTKKLSECLKRIGDELDSNMELQRMIATVDTNSPREVFFRVAADMF
                       **************************************************

A0A2K5Q7S1_BAX-02      SDGNFNWGRVVAFFYFASKLVLKVGSCRAVSPGIQTIISWGLSDSLLSYF
A0A2K5Q7S1_BAX-03      SDGNFNWGRVVAFFYFASKLVLK--------------------DSLLSYF
                       ***********************                    *******

A0A2K5Q7S1_BAX-02      GTPTWQTVTIFVAGVLTASLTIWKNMG
A0A2K5Q7S1_BAX-03      GTPTWQTVTIFVAGVLTASLTIWKNMG
                       ***************************

© 1998-2020Legal notice