Dataset for protein Bmf of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3SNN2_BMF-01      MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVA
A0A1S3P5K4_BMF-01      MDDEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVA
A0A1S3P5K4_BMF-02      MDDEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVA
                       ********* ** ***********************.*.***:*******

A0A1S3SNN2_BMF-01      QEPRPLFYGNAGFRLHFPARFEQVGDQGPQEQHQGERGRMERLQ---QQP
A0A1S3P5K4_BMF-01      QEPRPLFYGNAGFRLHFPAQFERVGDQGP----LGERGGMERLNQQPQQP
A0A1S3P5K4_BMF-02      QEPRPLFYGNAGFRLHFPAQFERVGDQGP----LGERGGMERLNQQPQQP
                       *******************.**.******     **** ****:   ***

A0A1S3SNN2_BMF-01      AQSMEVCIGQKLQLIGDQFYQEHLQL-------------------YHRNQ
A0A1S3P5K4_BMF-01      ARSIEICIGQKLQLIGDQFHQEHVQVVRIPNVTDCTAQLKPTEQAYCTQR
A0A1S3P5K4_BMF-02      ARSIEICIGQKLQLIGDQFHQEHVQV-------------------YHRNQ
                       *.*:*:*************:***:*:                   *  :.

A0A1S3SNN2_BMF-01      RNMR------------PMWWRLASALFTLLFEQEAIAGRGRAGWR----
A0A1S3P5K4_BMF-01      SAERETEQQKWLLYGHPLCSRLSVPCLFWLVSEHALAQCSDLSFYPPKT
A0A1S3P5K4_BMF-02      RNMR------------PLWRRLASALLTLLFEQEAIAGGERAGWR----
                          *            *:  **: . :  *..: *:*     .:     

© 1998-2020Legal notice