Dataset for protein Bad of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MLD5_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A096MLD5_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
                       **************************************************

A0A096MLD5_BAD-02      QQEQPTSSSHHGG---------RAWYSPSWESEDS--ENPSARMLAEASA
A0A096MLD5_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
                       *************         .: *... *.::.  *:**.    . **

A0A096MLD5_BAD-02      PMSAPATDSEAQHAENVKLKALGLWRRGVA---TAPTPRGRRRTKGWRRS
A0A096MLD5_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
                       * .  *::  ..   .:. : :. :..*:.   :* *.   *.:..* * 

A0A096MLD5_BAD-02      PAPFGAARAPRPPTSGQHSVMAASSGG
A0A096MLD5_BAD-01      FQSWWDRNLGRGSSAPSQ---------
                         .:   .  * .:: .:         

© 1998-2020Legal notice