Dataset for protein classical BH3-containing proteins of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7QLK6_PMAIP1-      MLQSVARQNAPSNPARAELAPEFIAQLRR---------------------
A0A1U7R468_HRK-01       --------MCPCPRHRGHGPPAVCGCGDTRPGLRWAAA------------
A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPA-----ERPPQLRPGAP------------
A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPA-----ERPPQLRPGAP------------
A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPA-----ERPPQLRPGAP------------
A0A1U8CPE0_BMF-01       ---------MEPPQCVEELEDDVFQSEDGEPGTQPGSL------------
A0A1U8CPE0_BMF-02       ----IFPGEMEPPQCVEELEDDVFQSEDGEPGTQPGSL------------
A0A1U7Q4V0_BAD-01       ---------MGTPKQPSLAPAHALGVRKSDPGIRSLGN----------DA
A0A1U7R5N5_BBC3-01      ---------MARARQEGSSPEPVEGLARDSPRPFPLGRLVPSAVSCGLCE
                                                                          

A0A1U7QLK6_PMAIP1-      --------------------------------------------------
A0A1U7R468_HRK-01       ------QVTALRLQALGDELHRRAMRRRAR--------------------
A0A1U8BW10_BCL2L11      ------TSLQTEQQ------------------------------------
A0A1U8BW10_BCL2L11      ------TSLQTEQQ------------------------------------
A0A1U8BW10_BCL2L11      ------TSLQTEQQGNPDGEGDRCPHGSPQGPLAPPASPGPSATRSPLFI
A0A1U8CPE0_BMF-01       --LSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A1U8CPE0_BMF-02       --LSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A1U7Q4V0_BAD-01       GGRRRRPAAQSMFQIPEFEPSEQEDSNTADRGLGPSLTGDP---------
A0A1U7R5N5_BBC3-01      PGLPAAPAAPALLPAAYLCAPTAPPAVTAALG-GPRWPGGPRSRPRGPRP
                                                                          

A0A1U7QLK6_PMAIP1-      --IGDKLSSEWCEPDIIAVLAEMPGKKARKSVTRIPSPTRVPTDVEDECV
A0A1U7R468_HRK-01       --------------------PRDPLP--------ALLPALRARWPWLCAA
A0A1U8BW10_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A1U8BW10_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A1U8BW10_BCL2L11      FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A1U8CPE0_BMF-01       PSQGVMLPCGV--------TEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
A0A1U8CPE0_BMF-02       PSQGVMLPCGV--------TEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
A0A1U7Q4V0_BAD-01       --PGPCLAPGLLGNIRHQQEQAANSSHHGGTGAMETRSRHSSYTAGNEED
A0A1U7R5N5_BBC3-01      DGPQPSLSPA---------QQHLESPVPSAPEALAGGPTQAAPGVRGEEE
                                                             .   .        

A0A1U7QLK6_PMAIP1-      H-------------------------------QLRRIGDKQN--------
A0A1U7R468_HRK-01       A-----------QVAALAA-------------------------------
A0A1U8BW10_BCL2L11      D-----------LCENLKHE------------------------------
A0A1U8BW10_BCL2L11      A-----------SIRQSQEEPADIRPEIWIAQELRRIGDEFNESYRRRVN
A0A1U8BW10_BCL2L11      A-----------SIRQSQEEPADIRPEIWIAQELRRIGDEFNESYRRRVN
A0A1U8CPE0_BMF-01       P----------------PEGQWQHRAEVQIARKLQCIADQFH--------
A0A1U8CPE0_BMF-02       P----------------PEGQWQHRAEVQIARKLQCIADQFH--------
A0A1U7Q4V0_BAD-01       EGMEEELSPFRGRSRSAPPNLWAAQ---RYGRELRRMSDEFEGSFKGLPR
A0A1U7R5N5_BBC3-01      E--------------------W-AR---EIGAQLRRMADDLNAQYE----
                                                                          

A0A1U7QLK6_PMAIP1-      ---------------LRQKLLNFISKLFSLVT----------
A0A1U7R468_HRK-01       ----------------------------WLLGRRSA------
A0A1U8BW10_BCL2L11      ----------------------------WQIHGDQSKS----
A0A1U8BW10_BCL2L11      NYQEDEDHPHHPQMVILQLL-RFIVRLVWRRH----------
A0A1U8BW10_BCL2L11      NYQEDEDHPHHPQMVILQLL-RFIVRLVWRRH----------
A0A1U8CPE0_BMF-01       -RLHIQQHQQNRDRAWWQVF-LFLQNLALNREENREGVGPW-
A0A1U8CPE0_BMF-02       -RLHIQQHQQNRDRAWWQVF-LFLQNLALNREENREGVGPW-
A0A1U7Q4V0_BAD-01       PKSAGTATQMRQSASWTRIIQSW-----WDRNLGKGGSTPSQ
A0A1U7R5N5_BBC3-01      -RRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN-
                                                                  

© 1998-2020Legal notice