Dataset for protein Bim of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8XIA2_BCL2L11      MFDSSRPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDYPQSCEGNQQ
A0A3P8XIA2_BCL2L11      ----------------------------------------RESSCEGNQQ
                                                                  .*******

A0A3P8XIA2_BCL2L11      SRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNK
A0A3P8XIA2_BCL2L11      SRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNK
                        **************************************************

A0A3P8XIA2_BCL2L11      STQTPSPSSQVITHAMRRLSKPQDTWRGYEAWPTPHHPYRPRPPPIAGDM
A0A3P8XIA2_BCL2L11      STQTPSPSSQVITHAMR-----------------------------PGDM
                        *****************                             .***

A0A3P8XIA2_BCL2L11      RPEILIGQELQRIGDEFNNLFIHGRLGARNGQVAQANLPQMHQEPAFLLW
A0A3P8XIA2_BCL2L11      RPEILIGQELQRIGDEFNNLFIHGVSGCSKMPVLHHLIYKPYQGPHCIKL
                        ************************  *. :  * :  : : :* *  :  

A0A3P8XIA2_BCL2L11      MGLLIGRLLQIIWRRR
A0A3P8XIA2_BCL2L11      S---------------
                                        

© 1998-2020Legal notice