Dataset for protein classical BH3-containing proteins of organism Equus asinus asinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4PGL2_PMAIP1-      --------------------------------------------------
A0A8C4LTR5_HRK-01       --------------------------------------------------
A0A8C4KX59_BIK-01       MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRL
A0A8C4L824_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A8C4L824_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A8C4L824_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A8C4L4F7_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGPR
A0A8C4MCB2_BMF-01       -----------------------MESPQCVEELEDDVFQPEDGEPGTQPR
A0A8C4MCB2_BMF-02       -----------------------MESPQCVEELEDDVFQPEDGEPGTQPR
A0A8C4MYJ3_BAD-02       -----------------------MFQIPEFEQSEPEDSSPADRGLGPSPT
A0A8C4MYJ3_BAD-01       -----------------------MFQIPEFEQSEPEDSSPADRGLGPSPT
                                                                          

A0A8C4PGL2_PMAIP1-      --------------------------------------------------
A0A8C4LTR5_HRK-01       -----------MCPCPLHRGRGPRAVCACSAGRLGLRSSAAQLTAARLKA
A0A8C4KX59_BIK-01       AFIGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNL
A0A8C4L824_BCL2L11      AERPPQLR-------------------------PGAPTSLQIEQQ-----
A0A8C4L824_BCL2L11      AERPPQLR-------------------------PGAPTSLQIEQQ-----
A0A8C4L824_BCL2L11      AERPPQLR-------------------------PGAPTSLQIEQQGNPGG
A0A8C4L4F7_BBC3-01      ---------------PFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAY
A0A8C4MCB2_BMF-01       SLLSADLFAPSQLDCPLSHLRLFPLTHCCG---PGLRPTSQEDKATQTLS
A0A8C4MCB2_BMF-02       SLLSADLFAPSQLDCPLSHLRLFPLTHCCG---PGLRPTSQEDKATQTLS
A0A8C4MYJ3_BAD-02       GDWPSD---------PVRHQR-------TA---PGLLGEAGHQQGQPASS
A0A8C4MYJ3_BAD-01       GDWPSD---------PVRHQR-------TA---PGLLGEAGHQQGQPASS
                                                                          

A0A8C4PGL2_PMAIP1-      --------------------------------------------------
A0A8C4LTR5_HRK-01       LGDEL---------------------------------------------
A0A8C4KX59_BIK-01       RENIRFWSFLTHR-------------------------------------
A0A8C4L824_BCL2L11      --------------------------------------------------
A0A8C4L824_BCL2L11      --------------------------------------------------
A0A8C4L824_BCL2L11      EGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD
A0A8C4L4F7_BBC3-01      LCAPAAPPAVTAALGGPRWPGGPR--------------------------
A0A8C4MCB2_BMF-01       PASPSQ-GVM--------LPCGVT--------------------------
A0A8C4MCB2_BMF-02       PASPSQ-GVM--------LPCGVT--------------------------
A0A8C4MYJ3_BAD-02       SHHGGA-GAVETRSRHSSYPEGTE--------------------------
A0A8C4MYJ3_BAD-01       SHHGGA-GAVETRSRHSSYPEGTE--------------------------
                                                                          

A0A8C4PGL2_PMAIP1-      -----MPTRKARKSGQPSPTRAPAE-------------------------
A0A8C4LTR5_HRK-01       -HQRTMWRRRARSRRAPEPGAL----------------------------
A0A8C4KX59_BIK-01       -DRVSLRFH-----DLDSPSCMCSP-------------------------
A0A8C4L824_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMR-----
A0A8C4L824_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMR-----
A0A8C4L824_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMR-----
A0A8C4L4F7_BBC3-01      -SRPRAP-----RPDGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGV
A0A8C4MCB2_BMF-01       -EEPQRLFYGNAGYRLPLPASFPAGLPLGEQPP-----------------
A0A8C4MCB2_BMF-02       -EEPQRLFYGNAGYRLPLPASFPAGLPLGEQPP-----------------
A0A8C4MYJ3_BAD-02       -DE---------GMEGEEPGPFRGR---SRSAP-----------------
A0A8C4MYJ3_BAD-01       -DE---------GMEGEEPGPFRGR---SRSAP-----------------
                                          *                               

A0A8C4PGL2_PMAIP1-      ----------LEAECAIQIRRIGDKLNFRQKLLNLIAKLFRSGT------
A0A8C4LTR5_HRK-01       ---PTYW---PWLCAAAQVAALAAWLLGRRNL------------------
A0A8C4KX59_BIK-01       ---LEPW---SSCPVGHSLAGCCSPHQSLLSSFACFTHSSSCLFPGPLGL
A0A8C4L824_BCL2L11      ---PEVW-------IAQELRRIGDEFNASYPRR-------------VMLF
A0A8C4L824_BCL2L11      ---PEVW-------IAQELRRIGDEFNASYPRR-------------VMLF
A0A8C4L824_BCL2L11      ---PEVW-------IAQELRRIGDEFNASYPRR-------------VMLF
A0A8C4L4F7_BBC3-01      RGEEEQW----AREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLY
A0A8C4MCB2_BMF-01       ---EGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQTLLFLH
A0A8C4MCB2_BMF-02       ---EGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMG-------------
A0A8C4MYJ3_BAD-02       ---PNLW---AALRYGRELRRMSDEFQGSFQAL-----------------
A0A8C4MYJ3_BAD-01       ---PNLW---AALRYGRELRRMSDEFQGSFQVSAGAARTPGPVLPGHLPL
                                       . .:                               

A0A8C4PGL2_PMAIP1-      --------------------------------------------------
A0A8C4LTR5_HRK-01       --------------------------------------------------
A0A8C4KX59_BIK-01       RWLAY---------------------------------------------
A0A8C4L824_BCL2L11      SLILFLPI------------------------PSPQQHIKKKTVTSNNSV
A0A8C4L824_BCL2L11      SLILFLPI------------------------PSPQQHIKKKTVTSNNSV
A0A8C4L824_BCL2L11      SLILFLPI------------------------PSPQQHIKKKTVTSNNSV
A0A8C4L4F7_BBC3-01      NLIMGLLPL-------------PRGRAAPEMEPN----------------
A0A8C4MCB2_BMF-01       NLAL------------------NGDENRNGAGPR----------------
A0A8C4MCB2_BMF-02       --AW------------------GGGESSGDGGPGPASGLRLPSLKDKVLE
A0A8C4MYJ3_BAD-02       ----------------------PRPKSAGTATQMRQSPSWTRAIQSWWDR
A0A8C4MYJ3_BAD-01       GCPIRVPVHVGTDVSGPLPSHGPVPKSQGMLGSVVPGPLPSH-------R
                                                                          

A0A8C4PGL2_PMAIP1-      -----------------
A0A8C4LTR5_HRK-01       -----------------
A0A8C4KX59_BIK-01       -----------------
A0A8C4L824_BCL2L11      LMLEMRGVTCV------
A0A8C4L824_BCL2L11      LMLEMRGVTCV------
A0A8C4L824_BCL2L11      LMLEMRGVTCV------
A0A8C4L4F7_BBC3-01      -----------------
A0A8C4MCB2_BMF-01       -----------------
A0A8C4MCB2_BMF-02       FWPNAVVIPVDWMGPTA
A0A8C4MYJ3_BAD-02       NLGRGGSAPSQ------
A0A8C4MYJ3_BAD-01       PVPESQGMPGSVVQTAP
                                         

© 1998-2022Legal notice