Dataset for protein Bim of organism Equus asinus asinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4L824_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ---------
A0A8C4L824_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQ---------
A0A8C4L824_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDR
                        *****************************************         

A0A8C4L824_BCL2L11      -----------------------------------------------DRS
A0A8C4L824_BCL2L11      -----------------------------------------------DRS
A0A8C4L824_BCL2L11      CPQGSPLGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                       ***

A0A8C4L824_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQEL
A0A8C4L824_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQEL
A0A8C4L824_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQEL
                        **************************************************

A0A8C4L824_BCL2L11      RRIGDEFNASYPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMR
A0A8C4L824_BCL2L11      RRIGDEFNASYPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMR
A0A8C4L824_BCL2L11      RRIGDEFNASYPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMR
                        **************************************************

A0A8C4L824_BCL2L11      GVTCV
A0A8C4L824_BCL2L11      GVTCV
A0A8C4L824_BCL2L11      GVTCV
                        *****

© 1998-2022Legal notice