Dataset for protein Bad of organism Equus asinus asinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4MYJ3_BAD-02      MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGH
A0A8C4MYJ3_BAD-01      MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGH
                       **************************************************

A0A8C4MYJ3_BAD-02      QQGQPASSSHHGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRSRSA
A0A8C4MYJ3_BAD-01      QQGQPASSSHHGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRSRSA
                       **************************************************

A0A8C4MYJ3_BAD-02      PPNLWAALRYGRELRRMSDEFQGSFQAL----------------------
A0A8C4MYJ3_BAD-01      PPNLWAALRYGRELRRMSDEFQGSFQVSAGAARTPGPVLPGHLPLGCPIR
                       **************************.                       

A0A8C4MYJ3_BAD-02      -----------------PRPKSAGTATQMRQSPSWTRAIQSWWDRNLGRG
A0A8C4MYJ3_BAD-01      VPVHVGTDVSGPLPSHGPVPKSQGMLGSVVPGPLPSH-------RPVPES
                                        * *** *   .:  .*  :.       * :  .

A0A8C4MYJ3_BAD-02      GSAPSQ------
A0A8C4MYJ3_BAD-01      QGMPGSVVQTAP
                        . *..      

© 1998-2022Legal notice