Dataset for protein Noxa of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A4IG90_PMAIP1-01      MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
Q0GKC8_PMAIP1-01      MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
                      *********************************************

© 1998-2023Legal notice