Dataset for protein Bik of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7FUT7_BIK-02      METPECAPVSGAGKTATHETKQVCRTAGGREAVNKPTGRTCSGSVANAIQTPVQHSALGV
F7FUT7_BIK-01      ------------------------MPQGAVRHYPSPRGRLPPPTPPGTFL--IYLSLVGL
                                            . *.     .* **  . : ..::   :  * :*:

F7FUT7_BIK-02      REAAPGAGRRGAGPGRGGASRSIRSRAGPRAADTTPLGWVADSAIIAATAAAAAAAAARG
F7FUT7_BIK-01      WGPSQQVCRWAPCPQFSPGPAPLLLSGSPRPEG--------------------------G
                   . .:  . *... *  . .. .:   ..**. .                          *

F7FUT7_BIK-02      EMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQL
F7FUT7_BIK-01      EMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQL
                   ************************************************************

F7FUT7_BIK-02      ACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLW
F7FUT7_BIK-01      ACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLW
                   ************************************************************

F7FUT7_BIK-02      RSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
F7FUT7_BIK-01      RSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
                   ************************************

© 1998-2020Legal notice