Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2EII1_BMF-01       ----------------------------------MEPPQCVEELEDDV--
Q05KI3_BMF-01           ----------------------------------MEPPQCVEELEDDV--
Q05KI3_BMF-02           ----------------------------------MEPPQCVEELEDDV--
A0A4W2INA4_BMF-01       ----------------------------------MEPPQCVEELEDDV--
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------MARARQEGSSPEPVEGLA
A0A4W2EKD9_BBC3-02      --------------------------------MARARQEGSSPEPVEGLA
A0A4W2C9A8_BAD-01       --------------------------MFQIPEFEQSEQEDSSPADRGL--
F1MUT9_BAD-01           --------------------------MFQIPEFEQSEQEDSSPADRGL--
Q3SYZ0_BAD-01           --------------------------MFQIPEFEQSEQEDSSRADRGL--
A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
A0A4W2D2G6_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
A0A4W2G3J8_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
A0A3Q1MV27_BCL2L11      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREG--
A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
A0A4W2D2G6_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
A0A4W2G3J8_BCL2L11      --------------------------------MAKQPSDVSSECDREG--
                                                                          

A0A3Q1NFP6_PMAIP1-      ---------------------------MPGRR------------------
A0A4W2CDL0_PMAIP1-      ---------------------------MPGRR------------------
A0A4W2CRW4_HRK-01       ---------------------MCPCPLHRGRGPPAVCACSAGRLGLRSSA
A0A4W2GVZ3_HRK-01       ---------------------MCPCPLHRGRGPPAVCACSAGRLGLRSSA
A0A4W2EII1_BMF-01       --------------------------FQPEDGEPGTQPRSLLSADLFAQS
Q05KI3_BMF-01           --------------------------FQPEDGEPGTQPRSLLSADLFAQS
Q05KI3_BMF-02           --------------------------FQPEDGEPGTQPRSLLSADLFAQS
A0A4W2INA4_BMF-01       --------------------------FQPEDGEPGTQPRSLLSADLFAQS
A0A4W2EKD9_BBC3-01      ---------------------VRATAEAARACPCQLPGAFF-SPWVPHQI
A0A3Q1LXZ6_BBC3-01      RDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAV
A0A4W2EKD9_BBC3-02      RDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAV
A0A4W2C9A8_BAD-01       ------------------------GPSPTGDRPPGLSKHWLTAPGLLGEA
F1MUT9_BAD-01           ------------------------GPSPTGDRPPGLSKHWLTAPGLLGEA
Q3SYZ0_BAD-01           ------------------------GPSPTGDRPPGLSKHWLTAPGLLGEA
A0A3Q1MV27_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A4W2D2G6_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A4W2G3J8_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A3Q1MV27_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A3Q1MV27_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A4W2D2G6_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
A0A4W2G3J8_BCL2L11      ------------------------GQLQPAERPPQLRP---GAPTSLQTE
                                                                          

A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2EII1_BMF-01       QLDCPLSRLQLFPLTHCCGPGLRPTSQE----------------------
Q05KI3_BMF-01           QLDCPLSRLQLFPLTHCCGPGLRPTSQE----------------------
Q05KI3_BMF-02           QLDCPLSRLQLFPLTHCCGPGLRPTSQE----------------------
A0A4W2INA4_BMF-01       QLDCPLSRLQLFPLTHCCGPGLRPTSQE----------------------
A0A4W2EKD9_BBC3-01      R-------------------------------------------------
A0A3Q1LXZ6_BBC3-01      TAALGAPRWPGGPRSRPRGPRPD---------------------------
A0A4W2EKD9_BBC3-02      TAALGAPRWPGGPRSRPRGPRPD---------------------------
A0A4W2C9A8_BAD-01       GHQQGQPAGS----------------------------------------
F1MUT9_BAD-01           GHQQGQPAGS----------------------------------------
Q3SYZ0_BAD-01           GHQQGQPAGS----------------------------------------
A0A3Q1MV27_BCL2L11      RQ------------------------------------------------
A0A4W2D2G6_BCL2L11      RQ------------------------------------------------
A0A4W2G3J8_BCL2L11      RQ------------------------------------------------
A0A3Q1MV27_BCL2L11      RQ------------------------------------------------
A0A3Q1MV27_BCL2L11      RQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
A0A4W2D2G6_BCL2L11      RQGNPEGEGDRCLQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
A0A4W2G3J8_BCL2L11      RQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
                                                                          

A0A3Q1NFP6_PMAIP1-      --------ARKSAQPSPTRVPADPEVECAI--------------------
A0A4W2CDL0_PMAIP1-      --------ARKSAQPSPTRVPADPEVECAI--------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPA
Q05KI3_BMF-01           --------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPA
Q05KI3_BMF-02           --------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPA
A0A4W2INA4_BMF-01       --------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
A0A4W2EKD9_BBC3-01      --------GPQPSLSPAEQHLESPVPSA----------------------
A0A3Q1LXZ6_BBC3-01      --------GPQPSLSPAEQHLESPVPSA----------------------
A0A4W2EKD9_BBC3-02      --------GPQPSLSPAEQHLESPVPSA----------------------
A0A4W2C9A8_BAD-01       --------SHHGGTGAVETRSRHSSYRAGPED------------------
F1MUT9_BAD-01           --------SHHGGTGAVETRSRHSSYRAGPED------------------
Q3SYZ0_BAD-01           --------SHHGGTGAVETRSRHSSYRAGPED------------------
A0A3Q1MV27_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A4W2D2G6_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A4W2G3J8_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A3Q1MV27_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A3Q1MV27_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A4W2D2G6_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN------------------
A0A4W2G3J8_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN------------------
                                                                          

A0A3Q1NFP6_PMAIP1-      -------------------------------QLRRIGDKLN---------
A0A4W2CDL0_PMAIP1-      -------------------------------QLRRIGDKLN---------
A0A4W2CRW4_HRK-01       -------------------------AQLTAARLKALGDELHQRTMWRRRA
A0A4W2GVZ3_HRK-01       -------------------------AQLTAARLKALGDELHQRTMWRRRA
A0A4W2EII1_BMF-01       SFPAGLPLGEQPPEGQWQHRAEIQIAR----KLQCIADQFHRLH------
Q05KI3_BMF-01           SFPAGLPLGEQPPEGQWQHRAEIQIAR----KLQCIADQFHRLH------
Q05KI3_BMF-02           SFPAGLPLGEQPPEGQWQHRAEIQIAR----KLQCIADQFHRLH------
A0A4W2INA4_BMF-01       SFPAGLPLGEQPPEGQWQHRAEIQIAR----KLQCIADQFHRLH------
A0A4W2EKD9_BBC3-01      ---PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQE
A0A3Q1LXZ6_BBC3-01      ---PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQE
A0A4W2EKD9_BBC3-02      ---PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQE
A0A4W2C9A8_BAD-01       NEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF--KGLP
F1MUT9_BAD-01           NEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF--KGLP
Q3SYZ0_BAD-01           NEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF--KGLP
A0A3Q1MV27_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A4W2D2G6_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A4W2G3J8_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A3Q1MV27_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A3Q1MV27_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A4W2D2G6_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
A0A4W2G3J8_BCL2L11      HYLSAMASMRQSQAVPADTRPEIWIAQ----ELRRIGDEFNAYYPRRVFV
                                                        *. :.*.::         

A0A3Q1NFP6_PMAIP1-      ------------FRQKLVNLISKLLRSGT----------
A0A4W2CDL0_PMAIP1-      ------------FRQKLVNLISKLLRSGT----------
A0A4W2CRW4_HRK-01       RSRRAPASGALPTYWPWLCAAAQVAALAAWLLGRRNL--
A0A4W2GVZ3_HRK-01       RSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL--
A0A4W2EII1_BMF-01       -MQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
Q05KI3_BMF-01           -MQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
Q05KI3_BMF-02           -MQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2INA4_BMF-01       -MQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2EKD9_BBC3-01      ERQRHRPSP----WRVLYNLIMGLLPFPGGRGAPEVEPN
A0A3Q1LXZ6_BBC3-01      ERQRHRPSP----WRVLYNLIMGLLPFPGGRGAPEVEPN
A0A4W2EKD9_BBC3-02      ERQRHRPSP----WRVLYNLIMGLLPFPGGRGAPEVEPN
A0A4W2C9A8_BAD-01       RPKSAGTATQMRQSPSWTRFLQ-SWLSRNLGRGGSAPSQ
F1MUT9_BAD-01           RPKSAGTATQMRQSPSWTRFLQ-SWLSRNLGRGGSAPSQ
Q3SYZ0_BAD-01           RPKSAGTATEMRQSPSWTRFLQ-SWLSRNLGRGGSAPSQ
A0A3Q1MV27_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A4W2D2G6_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A4W2G3J8_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A3Q1MV27_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A3Q1MV27_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A4W2D2G6_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
A0A4W2G3J8_BCL2L11      RHQAVEGHPQMVLLRVLRYIVRLVWRMQ-----------
                                                               

© 1998-2022Legal notice