Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------MARARQEGSSPEPVEGLARDGPRP
Q05KI3_BMF-02           --------------------------MEPPQCVEELEDDVFQPEDGEPGT
Q05KI3_BMF-01           --------------------------MEPPQCVEELEDDVFQPEDGEPGT
F1MUT9_BAD-01           --------------------------MFQIPEFEQSEQEDSSPADRGLGP
Q3SYZ0_BAD-01           --------------------------MFQIPEFEQSEQEDSSRADRGLGP
A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A3Q1MV27_BCL2L11      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
                                                                          

A0A3Q1NFP6_PMAIP1-      -------------------------------------MPGRRA-------
A0A3Q1LXZ6_BBC3-01      FPLSRLVPSAVSCGLCEPGLPAAP-AAPALLPAAYLCAPTAPP---AVTA
Q05KI3_BMF-02           QP-----RSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRP-------
Q05KI3_BMF-01           QP-----RSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRP-------
F1MUT9_BAD-01           SP-----TG------------DRP--------------PGLSKHWLTAPG
Q3SYZ0_BAD-01           SP-----TG------------DRP--------------PGLSKHWLTAPG
A0A3Q1MV27_BCL2L11      LQ-----PA------------ERP--------------PQLRP---GAPT
A0A3Q1MV27_BCL2L11      LQ-----PA------------ERP--------------PQLRP---GAPT
                                                              *           

A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      ALGAPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPT
Q05KI3_BMF-02           TSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPASFPA
Q05KI3_BMF-01           TSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPASFPA
F1MUT9_BAD-01           LLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGPEDNEETEEEDLGP
Q3SYZ0_BAD-01           LLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGPEDNEETEEEDLGP
A0A3Q1MV27_BCL2L11      SLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQ------
A0A3Q1MV27_BCL2L11      SLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQ------
                                                                          

A0A3Q1NFP6_PMAIP1-      --RKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQ--------------
A0A3Q1LXZ6_BBC3-01      QAAPGVRGEEEQWARE----IGAQLRRMADDLNALY------ERRRQEER
Q05KI3_BMF-02           GLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLH----------MQQY
Q05KI3_BMF-01           GLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLH----------MQQY
F1MUT9_BAD-01           FRGRSRSAPPNLWAAQ---RYGRELRRMSDEFHVSFKGLPRPKSAGTATQ
Q3SYZ0_BAD-01           FRGRSRSAPPNLWAAQ---RYGRELRRMSDEFHVSFKGLPRPKSAGTATE
A0A3Q1MV27_BCL2L11      --AVPADTRPEIWIAQ-------ELRRIGDEFNAYY---PRRVFVRHQAV
A0A3Q1MV27_BCL2L11      --AVPADTRPEIWIAQ-------ELRRIGDEFNAYY---PRRVFVRHQAV
                                               :*. :.*.::                 

A0A3Q1NFP6_PMAIP1-      ---------KLVNLISKLL-RSGT---------
A0A3Q1LXZ6_BBC3-01      QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
Q05KI3_BMF-02           QQNRNRMWWQILLFLHNVA-LNGDENRNGAGPR
Q05KI3_BMF-01           QQNRNRMWWQILLFLHNVA-LNGDENRNGAGPR
F1MUT9_BAD-01           MRQSPSWTRFLQSWLSRNL-GRGGSAPSQ----
Q3SYZ0_BAD-01           MRQSPSWTRFLQSWLSRNL-GRGGSAPSQ----
A0A3Q1MV27_BCL2L11      EGHPQMVLLRVLRYIVRLV-WRMQ---------
A0A3Q1MV27_BCL2L11      EGHPQMVLLRVLRYIVRLV-WRMQ---------
                                  :   :                  

© 1998-2020Legal notice