Dataset for protein Bad of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2C9A8_BAD-01      MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
F1MUT9_BAD-01          MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
Q3SYZ0_BAD-01          MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
                       **************** *********************************

A0A4W2C9A8_BAD-01      QQGQPAGSSHHGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRS
F1MUT9_BAD-01          QQGQPAGSSHHGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRS
Q3SYZ0_BAD-01          QQGQPAGSSHHGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRS
                       **************************************************

A0A4W2C9A8_BAD-01      APPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRF
F1MUT9_BAD-01          APPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRF
Q3SYZ0_BAD-01          APPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRF
                       ***************************************:**********

A0A4W2C9A8_BAD-01      LQSWLSRNLGRGGSAPSQ
F1MUT9_BAD-01          LQSWLSRNLGRGGSAPSQ
Q3SYZ0_BAD-01          LQSWLSRNLGRGGSAPSQ
                       ******************

© 1998-2022Legal notice