Dataset for protein Hrk of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CRW4_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
A0A4W2GVZ3_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
                       **************************************************

A0A4W2CRW4_HRK-01      RRRARSRRAPASGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A4W2GVZ3_HRK-01      RRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
                       ***********.*****************************

© 1998-2020Legal notice