Dataset for protein classical BH3-containing proteins of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CDL0_PMAIP1-      -------------------------------------------------M
A0A4W2CRW4_HRK-01       MCPCPLHRG-----------------------------------------
A0A4W2GVZ3_HRK-01       MCPCPLHRG-----------------------------------------
A0A4W2D2G6_BCL2L11      MAKQPSDVS------------------------------SECDREGGQLQ
A0A4W2G3J8_BCL2L11      MAKQPSDVS------------------------------SECDREGGQLQ
A0A4W2D2G6_BCL2L11      MAKQPSDVS------------------------------SECDREGGQLQ
A0A4W2G3J8_BCL2L11      MAKQPSDVS------------------------------SECDREGGQLQ
A0A4W2EKD9_BBC3-01      ---------------------------------------VRATAEAARAC
A0A4W2EKD9_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A4W2EII1_BMF-01       -MEPPQCVEELEDDV------------------------FQPEDG----E
A0A4W2INA4_BMF-01       -MEPPQCVEELEDDV------------------------FQPEDG----E
A0A4W2C9A8_BAD-01       MFQIPEFEQSEQEDS------------------------SPADRGLGPSP
                                                                          

A0A4W2CDL0_PMAIP1-      PGRRARKSA-----------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2D2G6_BCL2L11      PAERPPQL--RPGAPTSLQTERQGNPEGEGDRCLQGSPQGPLAPPASPGP
A0A4W2G3J8_BCL2L11      PAERPPQL--RPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGP
A0A4W2D2G6_BCL2L11      PAERPPQL--RPGAPTSLQTERQ---------------------------
A0A4W2G3J8_BCL2L11      PAERPPQL--RPGAPTSLQTERQ---------------------------
A0A4W2EKD9_BBC3-01      PCQLPGAFF-SPWVPHQIR-------------------------------
A0A4W2EKD9_BBC3-02      PALLPAAYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRPD---------
A0A4W2EII1_BMF-01       PGTQPRSLLSADLFAQSQL-DCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
A0A4W2INA4_BMF-01       PGTQPRSLLSADLFAQSQL-DCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
A0A4W2C9A8_BAD-01       TGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTG----AVETRSR
                                                                          

A0A4W2CDL0_PMAIP1-      -----------------------------QPSPTRVPADPEVE-------
A0A4W2CRW4_HRK-01       -----------------------------RGPPAVCACSAGRLGLRSSAA
A0A4W2GVZ3_HRK-01       -----------------------------RGPPAVCACSAGRLGLRSSAA
A0A4W2D2G6_BCL2L11      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A4W2G3J8_BCL2L11      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A4W2D2G6_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A4W2G3J8_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A4W2EKD9_BBC3-01      -----------------------------GPQPSLSPAEQHLESPVPSAP
A0A4W2EKD9_BBC3-02      -----------------------------GPQPSLSPAEQHLESPVPSAP
A0A4W2EII1_BMF-01       QTLSPAS----------------------PSQGVMLPCGVTEEPQRLFYG
A0A4W2INA4_BMF-01       QTLSPAS----------------------PSQGVMLPCGVTEEPQRLFYG
A0A4W2C9A8_BAD-01       HSSYRAG----------------------PEDNE----ETEEEDLGPFRG
                                                                          

A0A4W2CDL0_PMAIP1-      ----------------------------------CAIQLRRIGDKLNFRQ
A0A4W2CRW4_HRK-01       QL--------------------------------TAARLKALGDELHQRT
A0A4W2GVZ3_HRK-01       QL--------------------------------TAARLKALGDELHQRT
A0A4W2D2G6_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGDEFNAYY
A0A4W2G3J8_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGDEFNAYY
A0A4W2D2G6_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGDEFNAYY
A0A4W2G3J8_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGDEFNAYY
A0A4W2EKD9_BBC3-01      G------ALAGGPTQAAPGVRGEEEQW----AREIGAQLRRMADDLNALY
A0A4W2EKD9_BBC3-02      G------ALAGGPTQAAPGVRGEEEQW----AREIGAQLRRMADDLNALY
A0A4W2EII1_BMF-01       HAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFH---
A0A4W2INA4_BMF-01       NAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFH---
A0A4W2C9A8_BAD-01       RS-----------------RSAPPNLW---AAQRYGRELRRMSDEFHVSF
                                                           .  *. :.*.::   

A0A4W2CDL0_PMAIP1-      KLVNLISKLLRSGT---------------------------------
A0A4W2CRW4_HRK-01       MW----RRRARSRRAPASGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A4W2GVZ3_HRK-01       MW----RRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A4W2D2G6_BCL2L11      PR----RVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2G3J8_BCL2L11      PR----RVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2D2G6_BCL2L11      PR----RVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2G3J8_BCL2L11      PR----RVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2EKD9_BBC3-01      ER----RRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN--
A0A4W2EKD9_BBC3-02      ER----RRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN--
A0A4W2EII1_BMF-01       ------RLHMQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2INA4_BMF-01       ------RLHMQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2C9A8_BAD-01       KGLPRPKSAGTATQMRQSPSWTRFL----QSWLSRNLGRGGSAPSQ-
                                                                       

© 1998-2020Legal notice