Dataset for protein classical BH3-containing proteins of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CDL0_PMAIP1-      -------------------------MPGRRARK-----------------
A0A4W2CRW4_HRK-01       -------------------------------------MCPCPLHR-----
A0A4W2GVZ3_HRK-01       -------------------------------------MCPCPLHR-----
A0A4W2EII1_BMF-01       -MEPPQCVEELEDDVFQPEDG----EPGTQPRSLLSADLFAQSQL-DCPL
A0A4W2INA4_BMF-01       -MEPPQCVEELEDDVFQPEDG----EPGTQPRSLLSADLFAQSQL-DCPL
A0A4W2C9A8_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
A0A4W2EKD9_BBC3-01      ---------------VRATAEAARACPCQLPGAFFSPWVPHQI-------
A0A4W2EKD9_BBC3-02      --------------MARARQEGSSPEPVE---G-LARDGPRPFPL----S
A0A4W2D2G6_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ-LRPGAPTSLQT----E
A0A4W2G3J8_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ-LRPGAPTSLQT----E
A0A4W2D2G6_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ-LRPGAPTSLQT----E
A0A4W2G3J8_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQ-LRPGAPTSLQT----E
                                                                          

A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2EII1_BMF-01       SRLQLFPLTHCCGPGLRPTSQEDKATQTLS--------------------
A0A4W2INA4_BMF-01       SRLQLFPLTHCCGPGLRPTSQEDKATQTLS--------------------
A0A4W2C9A8_BAD-01       QQGQPAGSSHHGGTG----AVETRSRHSSY--------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      RLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWP
A0A4W2D2G6_BCL2L11      RQGNPEGEGDRCLQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
A0A4W2G3J8_BCL2L11      RQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
A0A4W2D2G6_BCL2L11      RQ------------------------------------------------
A0A4W2G3J8_BCL2L11      RQ------------------------------------------------
                                                                          

A0A4W2CDL0_PMAIP1-      --------SAQPSP-----TRVPADPEVE---------------------
A0A4W2CRW4_HRK-01       --------GRGPPA-------------------------------VCACS
A0A4W2GVZ3_HRK-01       --------GRGPPA-------------------------------VCACS
A0A4W2EII1_BMF-01       --------PASPSQ----GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPA
A0A4W2INA4_BMF-01       --------PASPSQ----GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPA
A0A4W2C9A8_BAD-01       --------RAGPED----NE----ETEEEDLGPFRGRS------------
A0A4W2EKD9_BBC3-01      ---------RGPQP-----SLSPAEQHLESPVPSAPG------ALAGGPT
A0A4W2EKD9_BBC3-02      GGPRSR--PRGPRPDGPQPSLSPAEQHLESPVPSAPG------ALAGGPT
A0A4W2D2G6_BCL2L11      SGYFSFDTDRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQ
A0A4W2G3J8_BCL2L11      SGYFSFDTDRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQ
A0A4W2D2G6_BCL2L11      --------DRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQ
A0A4W2G3J8_BCL2L11      --------DRSPAP-------MSCDKSTQTPSPPCQAFNHYLSAMASMRQ
                                   *                                      

A0A4W2CDL0_PMAIP1-      --------------------CAIQLRRIGDKLNFRQKLVNLISKLLRSGT
A0A4W2CRW4_HRK-01       AGRLGLRSSAAQL-------TAARLKALGDELHQRTMW----RRRARSRR
A0A4W2GVZ3_HRK-01       AGRLGLRSSAAQL-------TAARLKALGDELHQRTMW----RRRARSRR
A0A4W2EII1_BMF-01       GLPLGEQPPEGQWQHRAEIQIARKLQCIADQFH---------RLHMQQYQ
A0A4W2INA4_BMF-01       GLPLGEQPPEGQWQHRAEIQIARKLQCIADQFH---------RLHMQQYQ
A0A4W2C9A8_BAD-01       -----RSAPPNLW---AAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQ
A0A4W2EKD9_BBC3-01      QAAPGVRGEEEQW----AREIGAQLRRMADDLNALYER----RRQEERQR
A0A4W2EKD9_BBC3-02      QAAPGVRGEEEQW----AREIGAQLRRMADDLNALYER----RRQEERQR
A0A4W2D2G6_BCL2L11      SQAVPADTRPEIW-------IAQELRRIGDEFNAYYPR----RVFVRHQA
A0A4W2G3J8_BCL2L11      SQAVPADTRPEIW-------IAQELRRIGDEFNAYYPR----RVFVRHQA
A0A4W2D2G6_BCL2L11      SQAVPADTRPEIW-------IAQELRRIGDEFNAYYPR----RVFVRHQA
A0A4W2G3J8_BCL2L11      SQAVPADTRPEIW-------IAQELRRIGDEFNAYYPR----RVFVRHQA
                                             .  *. :.*.::                 

A0A4W2CDL0_PMAIP1-      ---------------------------------
A0A4W2CRW4_HRK-01       APASGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A4W2GVZ3_HRK-01       APAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A4W2EII1_BMF-01       QNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2INA4_BMF-01       QNRNRMWWQILLFLHNVALNGDENRNGAGPR--
A0A4W2C9A8_BAD-01       MRQSPSWTRFL----QSWLSRNLGRGGSAPSQ-
A0A4W2EKD9_BBC3-01      HRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN--
A0A4W2EKD9_BBC3-02      HRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN--
A0A4W2D2G6_BCL2L11      VEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2G3J8_BCL2L11      VEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2D2G6_BCL2L11      VEGHPQMVLLRVLRYIVRLVWRMQ---------
A0A4W2G3J8_BCL2L11      VEGHPQMVLLRVLRYIVRLVWRMQ---------
                                                         

© 1998-2020Legal notice