Dataset for protein Bim of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2D2G6_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
A0A4W2G3J8_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
A0A4W2D2G6_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
A0A4W2G3J8_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
                        *****************************************         

A0A4W2D2G6_BCL2L11      CLQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A4W2G3J8_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A4W2D2G6_BCL2L11      -----------------------------------------------DRS
A0A4W2G3J8_BCL2L11      -----------------------------------------------DRS
                                                                       ***

A0A4W2D2G6_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
A0A4W2G3J8_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
A0A4W2D2G6_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
A0A4W2G3J8_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
                        **************************************************

A0A4W2D2G6_BCL2L11      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2G3J8_BCL2L11      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2D2G6_BCL2L11      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2G3J8_BCL2L11      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
                        *********************************************

© 1998-2020Legal notice