Dataset for protein Puma of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2EKD9_BBC3-01      ---------------------------------------VRATAEAARAC
A0A4W2EKD9_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                                                                 .   ** *.

A0A4W2EKD9_BBC3-01      PCQLPGAFF-SPWVPHQIR----------------------GPQPSLSPA
A0A4W2EKD9_BBC3-02      PALLPAAYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRPDGPQPSLSPA
                        *. **.*:: :* .*  :                       *********

A0A4W2EKD9_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A4W2EKD9_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A4W2EKD9_BBC3-01      LYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
A0A4W2EKD9_BBC3-02      LYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
                        *******************************************

© 1998-2020Legal notice