Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             **                                                 
-----------------------------MEa------------------------------------------------
mfnlhgvlngaglkgyimrrglilvtfdl  rrnpsergvpagfsghasvesggetqespatvvfrppgnntdggaaaat
        y t  l h          s    t                f   sc      t        d    r    a
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------weclEdFsavRnlLeqssnstswf-wrflwGssqA---------kLvc
aaaaggsqaaaaaagaepmepesrpgpsgmnvvqva-l-pel-ri-tinedgqglkgvkrer-a-e-teevrnltfs-mt
  t                             ---- -y--- -- ---------- -----s-c-p   a   a - --
                                              k t     kt k v l  f               
                                                           l                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            :        :          
RikedykweFeellksCgelfDsLnlgh--qaLfqekviktlDFstpgRaaAaVAflsfiKdKwSeethlsg--------
-hrpe-cvt-qqikdn-anel-l-aqkysieq-ttywlqpgd--eeai-vy-k--lrpdcqygivklvnirnccyisgng
 ---- --- ------ ---- - ----  -- ---------  ---- -- -  ----v pesmstlpmq-        
 v     i   d                                     t           e g pk   n         
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------gy-------------------------------------------------
aeveidtedrvafrcsminmwpgvlgmdgvvimnvrftgpnfsgtvflantnlilhgvsfygfnntcveawtdvrvrgca
                             --                                                 
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fyccwkgvvcrpksrasikkclferctlgilsegnsrvrhnvasdcgcfmlvksvavikhnmvcgncedrasqmltcsdg
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------llDflaMhlWravv
nchllktihvashsrkawpvfehniltrcslhlgnrrgvflpyqcnlshtkillepesmskvnlngvf--mt-ki-kvlr
                                                                  --  -- -- ----
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rhknRllllssvRPaiipteeqqqq-------qqqEEaRrrrrqeq-spwnpragldpr---------------------
ydet-t----rcs-cecggkhirn-qqqqvmq--t-al-pdhlvlactraefgssdedtkchlvhipqwppelrriltin
----gmi   ---l---------- p   qqldv-n--w------- ---------fes                     
     -    a h    r lwpp          le hral  ge    llylq                           
                    q                t                                          
                                     p                                          

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
edgqglkgvkrergaseateevrnltfsfkisplaepvsgqqikdncaneldllaqkysieqlttywlqpgddfeeairv
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
yakvalrpdckykisklvnirnccyisgngaeveidtedrvafrcsminmwpgvlgmdgvvimnvrftgpnfsgtvflan
                                                                                
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tnlilhgpgfhrfvntcieawtdvrvrgcafyccwkgvvcrpksrasikkclferctlgilsegnsrvrhnvasdcgcfm
                                                                                
                                                                                
                                                                                
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lvksvavikhnmvcgncealssqlpttmlcinhslkiihvashsrkawpvfehniltrcslhlgnrrgvflpyqcnlsht
                                                                                
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
killepmvmskvnlngvfdmtmkiwkvlrydetrtrcrpcecggkhirnqpvmldvteelrpdhlvlactraefgssded
                                                                                
                                                                                
                                                                                
                                                                                

  
..
 .
-e
td
 h
  
  
  
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice