Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .  .   *    . .               
-----------------------------meawecledfsavrnlleqssnstswfwRflwgssqaklvcrikedykwef
mfnlhgvlngaglkgyimrrglilvtfdl--------------------merrnpse gvpagfsgh-------------
        y t  l h     merrnssergvpagfsghaf esgg tqestvvf ppgnntdpgaaaav        
                          p    t                      ktk v ls c       t        
                                                          l                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :      :                     **                                            
eellkScGElfdSlnlghqalfqekvikTldFstPGraaaa---------------------------------------
-asveagcgtqeapa--------------vv-rp  nntdgrgaaaaaaaaggsqaaaaagaepmeflamhlwravvrhk
 ---a a  s a ata aepmep      --  r  psg--gagflstitgkwqeethls gylld              
 df   s                             dv    v  g g kd s a                         
                                     t         f                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nrllllsavhlaiiptlwppesrpwlrrgeeqsllylqsglgpsgmnvvqvaelfpelrriltinedgqglkgvkrerga
                    qnh                  d rkchl hipqwy         t               
                                                      p                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
seateevrnltfslmtrhrpecvtfqqikdncaneldllaqkysieqlttywlqpgddfeeairvyakvalrpdckykis
c     a   a  fkispla pisg                                                       
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------VAFlsfikdkWseethlsGgylldf------------------------------
klvnirnccyisgngaeveidtedr---rcsminm-pgvlgmd-vvimnvrftgpnfsgtvflantnlilhgvsfygfnn
                            -------s------- ------                      pg hr v 
                            mnvvqpe mskvn n  fd                                 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tcveawtdvrvrgcafyccwkgvvcrpksrasikkclferctlgilsegnsrvrhnvasdcgcfmlvksvavikhnmvcg
  i                                                                             
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ncedrasqmltcsdgnchllktihvashsrkawpvfehniltrcslhlgnrrgvflpyqcnlshtkillepesmskvnln
   als  lp tmlcin s  i                                                 mv       
                                                                                
                                                                                

       570       580       590       600       610       620       630       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
                       .                                              . :    
----laMhlWravvrhknRllllssvRPaiiptee------qqqqqqqqeearrrRrqeqspwnpRAgldpre----
gvfdmt-ki-kvlrydet-----trcsececggkhqqqqqq--n-pvmldvteel-pdhlvlact--efgssdedtd
    -- -- --------gmi mnv q ggvtelq      ir- -----ar--- ---------  --- mqfesh
                              pr  -            leq--a                        
                                                   e                         
© 1998-2022Legal notice