Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Alignment] [Repertoires]

39 sequence(s)

>gnl|bcl2dbpro|A0A0G2R248_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A0G2R248_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=496 residues).
MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNVVQV
AELYPELRRILTITEDGQGLKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTY
WLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVR
FTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLV
LACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A291P1B2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
METWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A2H4PJ75_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=178 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQEEARRR
RRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ54_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQEE
ARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJZ5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRVAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNGLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK00_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=210 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK78_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=209 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HLF7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SND6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNH4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNY0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SP19_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SPV1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=215 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SSS2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIPTEEQQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A6M4W5T4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQEETRR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7D0TLU2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=626 residues).
MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSSNSTSKTKRLLLSSFQPKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYLQSGLDPRKCHLVHIPQWPPELRRILTINEDGQGLKGVKRERGAS
EATEEVRNLTFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISK
LVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGPGFHRFVNT
CIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
CEALSSQLPTTMLCINHSLKIIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPMVMSKVNLNG
VFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A7D0TN91_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=192 residues).
MRRGLILVTSDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRVLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLG
HQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE
QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WG90_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=183 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQQE
EARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WGT1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=171 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEEARRRRRQEQSP
WNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WIC2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLILLSSVRPAIIPTEQQQQQQQQQQQEE
ARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WIG2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQLQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WJT1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=184 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQQQ
EEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WK62_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=178 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIRTEEQQQQQQEEARRR
RRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1ARN8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1ARN8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=500 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQ
LTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVI
MNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILS
EGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLH
LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRP
DHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|E1ARN8_E1B19K-04 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=97 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQEGGVPTLPMQFESH
>gnl|bcl2dbpro|E1ARN8_E1B19K-03 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=160 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J7I6T8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=499 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAAAAAGGSQAAAAAGAEPMEPESRPGPSGMNV
VQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIM
NVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSE
GNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHL
GNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPD
HLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J7I6T8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4H6_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=501 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGRAAAAAAAAAGGSQAAAAAGAEPMEPESRPGPSGM
NVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIE
QLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVV
IMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGIL
SEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSL
HLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELR
PDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J9Z4H6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4N4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=177 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
RQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4N4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=497 residues).
MERRNPSERGVPAGFSGHAFVESSGETQESPATVVFRPPGNNTDGGAAAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQ
VAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTT
YWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNV
RFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGN
RRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHL
VLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J9Z5H0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z5H0_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=495 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPESRPGPSGMNVVQVA
ELFPELRRILTINEDGQGLKGVKRERGASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYW
LQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRF
TGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSR
VRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRR
GVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVL
ACTRAEFGSSDEDTD
>gnl|bcl2dbpro|T1UG63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRTAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|T1UG63_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=501 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAAGAEPMEPESRPGPSGM
NVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIE
QLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVV
IMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGIL
SEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSL
HLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELR
PDHLVLACTRAEFGSSDEDTD
© 1998-2021Legal notice