Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

40 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9Z5H0_E1B19K-02        -------------------------------------------------M
J9Z4N4_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
J7I6T8_E1B19K-02        -------------------------------------------------M
J9Z4H6_E1B19K-02        -------------------------------------------------M
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A0G2R248_E1B19K-      -------------------------------------------------M
E1ARN8_E1B19K-02        -------------------------------------------------M
E1ARN8_E1B19K-04        ---------------------------------------MERRNPSERGV
E1ARN8_E1B19K-03        ---------------------------------------MERRNPSERGV
A0A3Q9HK00_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3Q9HK78_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SPV1_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A7L4WGT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SND6_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SP19_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A291P1B2_E1B19K-      -----------------------------METWECLEDFSAVRNLLEQSS
T1UG63_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A8F9W8V2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLKQSS
J9Z5H0_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4N4_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJZ5_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WG90_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4H6_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A6M4W5T4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIG2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J7I6T8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WK62_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNH4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A0G2R248_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ54_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7D0TN91_E1B19K-      -----------------MRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SSS2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNY0_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A2H4PJ75_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ63_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIC2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WJT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HLF7_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
E1ARN8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
                                                                          

J9Z5H0_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J9Z4N4_E1B19K-02        ERRNPSERGVPAGFSGH--------------AFVESSGETQESPA-----
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J9Z4H6_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A0G2R248_E1B19K-      ERRNPSERGVPAGFSGH--------------ASVESGCETQESPA-----
E1ARN8_E1B19K-02        ERRNPSERGVPAGFSGH--------------AFVESGGETQESPT-----
E1ARN8_E1B19K-04        PAG------------------------FSGHAFVESGGETQESPT-----
E1ARN8_E1B19K-03        PAG------------------------FSGHAFVESGGETQESPT-----
A0A3Q9HK00_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HK78_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SPV1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WGT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SND6_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SP19_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQA
A0A291P1B2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
T1UG63_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A8F9W8V2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z5H0_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4N4_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJZ5_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WG90_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4H6_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A6M4W5T4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIG2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J7I6T8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WK62_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNH4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A0G2R248_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ54_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7D0TN91_E1B19K-      NSTSWFWRVLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SSS2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNY0_E1B19K-      NSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A2H4PJ75_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ63_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIC2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WJT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HLF7_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
E1ARN8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
                                                         ::*  *  :*       

J9Z5H0_E1B19K-02        --------TVVFRPPGNNTDG------GATAGGSQAAAAAGAEPME----
J9Z4N4_E1B19K-02        --------TVVFRPPGNNTDG----GAAAAAGGSQAAAAAGAEPME----
T1UG63_E1B19K-02        --------TVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAAGAEPME----
J7I6T8_E1B19K-02        --------TVVFRPPGNNTDG--GAAAAAAAGGSQAAAAAGAEPME----
J9Z4H6_E1B19K-02        --------TVVFRPPGNNTDGRAAAAAAAAAGGSQAAAAAGAEPME----
A0A7D0TLU2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-VAFLSFIKDKWSEETHLSGGYLLDFLAM
A0A0G2R248_E1B19K-      --------TVVFRPPGDNTDG-GAA---AAAGGSQ-AAAAGAEPME----
E1ARN8_E1B19K-02        --------TVVFRPPGNNTDG-GAAAATAAAGGSQAAAAAGAEPME----
E1ARN8_E1B19K-04        --------TVVFRPPGNNTDG-----------------------------
E1ARN8_E1B19K-03        --------TVVFRPPGNNTDG-----------------------------
A0A3Q9HK00_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HK78_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SPV1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WGT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SND6_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SP19_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A291P1B2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
T1UG63_E1B19K-01        LFQEKVIKTLDFSTPGRTAAA-----------------------------
A0A8F9W8V2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J9Z5H0_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
J9Z4N4_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJZ5_E1B19K-      LFQEKVIKTLDFSTPGRVAAA-----------------------------
A0A7L4WG90_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J9Z4H6_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A6M4W5T4_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WIG2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J7I6T8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WK62_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SNH4_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A0G2R248_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJ54_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7D0TN91_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SSS2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SNY0_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A2H4PJ75_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJ63_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WIC2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WJT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HLF7_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
E1ARN8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
                                *: * .**  : .                             

J9Z5H0_E1B19K-02        -----------------------------PESRP----------------
J9Z4N4_E1B19K-02        -----------------------------PESRP----------------
T1UG63_E1B19K-02        -----------------------------PESRP----------------
J7I6T8_E1B19K-02        -----------------------------PESRP----------------
J9Z4H6_E1B19K-02        -----------------------------PESRP----------------
A0A7D0TLU2_E1B19K-      HLWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYLQSG
A0A0G2R248_E1B19K-      -----------------------------PESRP----------------
E1ARN8_E1B19K-02        -----------------------------PESRP----------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEARNL
J9Z4N4_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
T1UG63_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
J7I6T8_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
J9Z4H6_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
A0A7D0TLU2_E1B19K-      LDPRKCHLVHIPQWPPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
A0A0G2R248_E1B19K-      -GPSGMNVVQVAELYPELRRILTITEDGQGLKGVKRERGACEATEEARNL
E1ARN8_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J9Z4N4_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
T1UG63_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J7I6T8_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J9Z4H6_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
A0A7D0TLU2_E1B19K-      TFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
A0A0G2R248_E1B19K-      AFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
E1ARN8_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J9Z4N4_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
T1UG63_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J7I6T8_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J9Z4H6_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
A0A7D0TLU2_E1B19K-      EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
A0A0G2R248_E1B19K-      EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
E1ARN8_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
E1ARN8_E1B19K-04        ---------------------------------------------GAAAA
E1ARN8_E1B19K-03        ---------------------------------------------GAAAA
A0A3Q9HK00_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HK78_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SPV1_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WGT1_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SND6_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SP19_E1B19K-      ---------------------------------------------VAFLS
A0A291P1B2_E1B19K-      ---------------------------------------------VAFLS
T1UG63_E1B19K-01        ---------------------------------------------VAFLS
A0A8F9W8V2_E1B19K-      ---------------------------------------------VAFLS
J9Z5H0_E1B19K-01        ---------------------------------------------VAFLS
J9Z4N4_E1B19K-01        ---------------------------------------------VAFLS
A0A3Q9HJZ5_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WG90_E1B19K-      ---------------------------------------------VAFLS
J9Z4H6_E1B19K-01        ---------------------------------------------VAFLS
A0A6M4W5T4_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WIG2_E1B19K-      ---------------------------------------------VAFLS
J7I6T8_E1B19K-01        ---------------------------------------------VAFLS
A0A7L4WK62_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SNH4_E1B19K-      ---------------------------------------------VAFLS
A0A0G2R248_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HJ54_E1B19K-      ---------------------------------------------VAFLS
A0A7D0TN91_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SSS2_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SNY0_E1B19K-      ---------------------------------------------VAFLS
A0A2H4PJ75_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HJ63_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WIC2_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WJT1_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HLF7_E1B19K-      ---------------------------------------------VAFLS
E1ARN8_E1B19K-01        ---------------------------------------------VAFLS
                                                                      *  .

J9Z5H0_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
J9Z4N4_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
T1UG63_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
J7I6T8_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
J9Z4H6_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
A0A7D0TLU2_E1B19K-      SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGP
A0A0G2R248_E1B19K-      SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
E1ARN8_E1B19K-02        SMINMWPGVLGMDGVVIMN-------VRFTGPNFSGTVFLANTNLILHGV
E1ARN8_E1B19K-04        TAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQEGGVPTLP---------
E1ARN8_E1B19K-03        TAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQPESMSKVN---------
A0A3Q9HK00_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3Q9HK78_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SPV1_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WGT1_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SND6_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SP19_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A291P1B2_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
T1UG63_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A8F9W8V2_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
J9Z5H0_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
J9Z4N4_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3Q9HJZ5_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WG90_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
J9Z4H6_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A6M4W5T4_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WIG2_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
J7I6T8_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WK62_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SNH4_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A0G2R248_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3Q9HJ54_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7D0TN91_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SSS2_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3S9SNY0_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A2H4PJ75_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3Q9HJ63_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WIC2_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A7L4WJT1_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
A0A3Q9HLF7_E1B19K-      FIKDKWSEETHLSGGYLLD-------------------FLA---------
E1ARN8_E1B19K-01        FIKDKWSEETHLSGGYLLD-------------------FLA---------
                              .      *   ::                    :          

J9Z5H0_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
J9Z4N4_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
T1UG63_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
J7I6T8_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
J9Z4H6_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
A0A7D0TLU2_E1B19K-      GFHRFVNTCIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
A0A0G2R248_E1B19K-      SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
E1ARN8_E1B19K-02        SFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTL
E1ARN8_E1B19K-04        -----------------------M--------------------------
E1ARN8_E1B19K-03        -----------------------LNGVFDMTMKIW---------------
A0A3Q9HK00_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3Q9HK78_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SPV1_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7L4WGT1_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SND6_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SP19_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A291P1B2_E1B19K-      -----------------------MHLWRAVVRHKN---------------
T1UG63_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
A0A8F9W8V2_E1B19K-      -----------------------MHLWRAVVRHKN---------------
J9Z5H0_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
J9Z4N4_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
A0A3Q9HJZ5_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7L4WG90_E1B19K-      -----------------------MHLWRAVVRHKN---------------
J9Z4H6_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
A0A6M4W5T4_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7L4WIG2_E1B19K-      -----------------------MHLWRAVVRHKN---------------
J7I6T8_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
A0A7L4WK62_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SNH4_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A0G2R248_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3Q9HJ54_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7D0TN91_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SSS2_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3S9SNY0_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A2H4PJ75_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3Q9HJ63_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7L4WIC2_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A7L4WJT1_E1B19K-      -----------------------MHLWRAVVRHKN---------------
A0A3Q9HLF7_E1B19K-      -----------------------MHLWRAVVRHKN---------------
E1ARN8_E1B19K-01        -----------------------MHLWRAVVRHKN---------------
                                                                          

J9Z5H0_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
J9Z4N4_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
T1UG63_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
J7I6T8_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
J9Z4H6_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
A0A7D0TLU2_E1B19K-      GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEALSSQLPTTM
A0A0G2R248_E1B19K-      GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
E1ARN8_E1B19K-02        GILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCS
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
J9Z4N4_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
T1UG63_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
J7I6T8_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
J9Z4H6_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
A0A7D0TLU2_E1B19K-      LCINHSLKIIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
A0A0G2R248_E1B19K-      DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
E1ARN8_E1B19K-02        DGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLS
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
J9Z4N4_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
T1UG63_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
J7I6T8_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
J9Z4H6_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
A0A7D0TLU2_E1B19K-      HTKILLEPMVMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
A0A0G2R248_E1B19K-      HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
E1ARN8_E1B19K-02        HTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIR
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        ---------------------------KVLRYDETRTRCRPCECGGKHIR
A0A3Q9HK00_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE-----Q
A0A3Q9HK78_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A3S9SPV1_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEEQQQQQQ
A0A7L4WGT1_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A3S9SND6_E1B19K-      ---------------------------RMLLLSSVRPAIIPTEE------
A0A3S9SP19_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A291P1B2_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
T1UG63_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE-----Q
A0A8F9W8V2_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
J9Z5H0_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE------
J9Z4N4_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE------
A0A3Q9HJZ5_E1B19K-      ---------------------------GLLLLSSVRPAIIPTEE-----Q
A0A7L4WG90_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE---QQQ
J9Z4H6_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE-----Q
A0A6M4W5T4_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A7L4WIG2_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
J7I6T8_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE------
A0A7L4WK62_E1B19K-      ---------------------------RMLLLSSVRPAIIRTEE------
A0A3S9SNH4_E1B19K-      ---------------------------RMLLLSSVRPAIIPTEE------
A0A0G2R248_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A3Q9HJ54_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A7D0TN91_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A3S9SSS2_E1B19K-      ---------------------------RLLLLSSVRPAIPTEEQ------
A0A3S9SNY0_E1B19K-      ---------------------------RLLLLSSVSPAIIPTEE------
A0A2H4PJ75_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE------
A0A3Q9HJ63_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE----QQ
A0A7L4WIC2_E1B19K-      ---------------------------RLILLSSVRPAIIPTEQ----QQ
A0A7L4WJT1_E1B19K-      ---------------------------RLLLLSSVRPAIIPTEE--QQQQ
A0A3Q9HLF7_E1B19K-      ---------------------------RLLLLSSVSPAIIPTEE------
E1ARN8_E1B19K-01        ---------------------------RLLLLSSVRPAIIPTEE------
                                                                          

J9Z5H0_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J9Z4N4_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
T1UG63_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J7I6T8_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J9Z4H6_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A7D0TLU2_E1B19K-      NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A0G2R248_E1B19K-      NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
E1ARN8_E1B19K-02        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
E1ARN8_E1B19K-04        ------------------------QFESH-----
E1ARN8_E1B19K-03        NQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A3Q9HK00_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3Q9HK78_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SPV1_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A7L4WGT1_E1B19K-      ---------EARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SND6_E1B19K-      -QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SP19_E1B19K-      -----QQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A291P1B2_E1B19K-      -----QQQEEARRRRRQEQSPWNPRAGLDPRE--
T1UG63_E1B19K-01        QQQQQQQEEARRRRRRQEQSPWNPRAGLDPRE--
A0A8F9W8V2_E1B19K-      -----QQQEEARRRRRQEQSPWNPRAGLDPRE--
J9Z5H0_E1B19K-01        -----QQQEEARRRRRQEQSPWNPRAGLDPRE--
J9Z4N4_E1B19K-01        ---QQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3Q9HJZ5_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A7L4WG90_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
J9Z4H6_E1B19K-01        QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A6M4W5T4_E1B19K-      -QQQQQQQEETRRRRRQEQSPWNPRAGLDPRE--
A0A7L4WIG2_E1B19K-      -QQQQQLQEEARRRRRQEQSPWNPRAGLDPRE--
J7I6T8_E1B19K-01        -QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A7L4WK62_E1B19K-      --QQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SNH4_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A0G2R248_E1B19K-      ----QQQQQEEARRRRQEQSPWNPRAGLDPRE--
A0A3Q9HJ54_E1B19K-      ----QQQEEARRRRRRQEQSPWNPRAGLDPRE--
A0A7D0TN91_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SSS2_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3S9SNY0_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A2H4PJ75_E1B19K-      --QQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3Q9HJ63_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A7L4WIC2_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A7L4WJT1_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
A0A3Q9HLF7_E1B19K-      QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
E1ARN8_E1B19K-01        QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE--
                                                          

© 1998-2022Legal notice