Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q9HK00_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3Q9HK78_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SPV1_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SNH4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A0G2R248_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ54_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SSS2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNY0_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A2H4PJ75_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ63_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HLF7_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
E1ARN8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SND6_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SP19_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A291P1B2_E1B19K-      -----------------------------METWECLEDFSAVRNLLEQSS
J9Z5H0_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
T1UG63_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4N4_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJZ5_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J7I6T8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4H6_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
                                                     **:******************

A0A3Q9HK00_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HK78_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SPV1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNH4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A0G2R248_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ54_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SSS2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNY0_E1B19K-      NSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A2H4PJ75_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ63_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HLF7_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
E1ARN8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SND6_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SP19_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQA
A0A291P1B2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z5H0_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
T1UG63_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4N4_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJZ5_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J7I6T8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4H6_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
                        *************.*******:*********:******************

A0A3Q9HK00_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HK78_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SPV1_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SNH4_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A0G2R248_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HJ54_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SSS2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SNY0_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A2H4PJ75_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HJ63_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HLF7_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
E1ARN8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SND6_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SP19_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A291P1B2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J9Z5H0_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
T1UG63_E1B19K-01        LFQEKVIKTLDFSTPGRTAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J9Z4N4_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HJZ5_E1B19K-      LFQEKVIKTLDFSTPGRVAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J7I6T8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J9Z4H6_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
                        *****************.********************************

A0A3Q9HK00_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE-----QQQQQQQQQEEARRRRRQ
A0A3Q9HK78_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE------QQQQQQQQEEARRRRRQ
A0A3S9SPV1_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQQQQQEEARRRRRQ
A0A3S9SNH4_E1B19K-      LWRAVVRHKNRMLLLSSVRPAIIPTEE------QQQQQQQQEEARRRRRQ
A0A0G2R248_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE----------QQQQQEEARRRRQ
A0A3Q9HJ54_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE----------QQQEEARRRRRRQ
A0A3S9SSS2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIPTEEQ------QQQQQQQQEEARRRRRQ
A0A3S9SNY0_E1B19K-      LWRAVVRHKNRLLLLSSVSPAIIPTEE------QQQQQQQQEEARRRRRQ
A0A2H4PJ75_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE--------QQQQQQEEARRRRRQ
A0A3Q9HJ63_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE----QQQQQQQQQQEEARRRRRQ
A0A3Q9HLF7_E1B19K-      LWRAVVRHKNRLLLLSSVSPAIIPTEE------QQQQQQQQEEARRRRRQ
E1ARN8_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE------QQQQQQQQEEARRRRRQ
A0A3S9SND6_E1B19K-      LWRAVVRHKNRMLLLSSVRPAIIPTEE-------QQQQQQQEEARRRRRQ
A0A3S9SP19_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE-----------QQQEEARRRRRQ
A0A291P1B2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE-----------QQQEEARRRRRQ
J9Z5H0_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE-----------QQQEEARRRRRQ
T1UG63_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE-----QQQQQQQQEEARRRRRRQ
J9Z4N4_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE---------QQQQQEEARRRRRQ
A0A3Q9HJZ5_E1B19K-      LWRAVVRHKNGLLLLSSVRPAIIPTEE-----QQQQQQQQQEEARRRRRQ
J7I6T8_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE-------QQQQQQQEEARRRRRQ
J9Z4H6_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTEE-----QQQQQQQQQEEARRRRRQ
                        ********** :****** *** . *:           **::   *****

A0A3Q9HK00_E1B19K-      EQSPWNPRAGLDPRE
A0A3Q9HK78_E1B19K-      EQSPWNPRAGLDPRE
A0A3S9SPV1_E1B19K-      EQSPWNPRAGLDPRE
A0A3S9SNH4_E1B19K-      EQSPWNPRAGLDPRE
A0A0G2R248_E1B19K-      EQSPWNPRAGLDPRE
A0A3Q9HJ54_E1B19K-      EQSPWNPRAGLDPRE
A0A3S9SSS2_E1B19K-      EQSPWNPRAGLDPRE
A0A3S9SNY0_E1B19K-      EQSPWNPRAGLDPRE
A0A2H4PJ75_E1B19K-      EQSPWNPRAGLDPRE
A0A3Q9HJ63_E1B19K-      EQSPWNPRAGLDPRE
A0A3Q9HLF7_E1B19K-      EQSPWNPRAGLDPRE
E1ARN8_E1B19K-01        EQSPWNPRAGLDPRE
A0A3S9SND6_E1B19K-      EQSPWNPRAGLDPRE
A0A3S9SP19_E1B19K-      EQSPWNPRAGLDPRE
A0A291P1B2_E1B19K-      EQSPWNPRAGLDPRE
J9Z5H0_E1B19K-01        EQSPWNPRAGLDPRE
T1UG63_E1B19K-01        EQSPWNPRAGLDPRE
J9Z4N4_E1B19K-01        EQSPWNPRAGLDPRE
A0A3Q9HJZ5_E1B19K-      EQSPWNPRAGLDPRE
J7I6T8_E1B19K-01        EQSPWNPRAGLDPRE
J9Z4H6_E1B19K-01        EQSPWNPRAGLDPRE
                        ***************

© 1998-2020Legal notice