Dataset for protein E1B 19K of organism Human mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

39 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9Z5H0_E1B19K-02        -------------------------------------------------M
J9Z4N4_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
J7I6T8_E1B19K-02        -------------------------------------------------M
J9Z4H6_E1B19K-02        -------------------------------------------------M
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A0G2R248_E1B19K-      -------------------------------------------------M
E1ARN8_E1B19K-02        -------------------------------------------------M
E1ARN8_E1B19K-04        ---------------------MERRNPSERGVPAGFSGHAFVESGGETQE
E1ARN8_E1B19K-03        ---------------------MERRNPSERGVPAGFSGHAFVESGGETQE
A0A3Q9HK00_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3Q9HK78_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SPV1_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A7L4WGT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SND6_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SP19_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A291P1B2_E1B19K-      -----------------------------METWECLEDFSAVRNLLEQSS
J9Z5H0_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
T1UG63_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4N4_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJZ5_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WG90_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J9Z4H6_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A6M4W5T4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIG2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J7I6T8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WK62_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNH4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A0G2R248_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ54_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7D0TN91_E1B19K-      -----------------MRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SSS2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNY0_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A2H4PJ75_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ63_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIC2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WJT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3Q9HLF7_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
E1ARN8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
                                                                          

J9Z5H0_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J9Z4N4_E1B19K-02        ERRNPSERGVPAGFSGH--------------AFVESSGETQESPA-----
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
J9Z4H6_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A0G2R248_E1B19K-      ERRNPSERGVPAGFSGH--------------ASVESGCETQESPA-----
E1ARN8_E1B19K-02        ERRNPSERGVPAGFSGH--------------AFVESGGETQESPT-----
E1ARN8_E1B19K-04        SPTTVVFRPPGNNTDGGAAAAT------------AAAGGSQAAAAAGAEP
E1ARN8_E1B19K-03        SPTTVVFRPPGNNTDGGAAAAT------------AAAGGSQAAAAAGAEP
A0A3Q9HK00_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HK78_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SPV1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WGT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SND6_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SP19_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQA
A0A291P1B2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z5H0_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
T1UG63_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4N4_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJZ5_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WG90_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J9Z4H6_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A6M4W5T4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIG2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J7I6T8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WK62_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNH4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A0G2R248_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ54_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7D0TN91_E1B19K-      NSTSWFWRVLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SSS2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNY0_E1B19K-      NSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A2H4PJ75_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ63_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIC2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WJT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HLF7_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
E1ARN8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
                        .  .   *    . .                    :      :       

J9Z5H0_E1B19K-02        --------TVVFRPPGNNTDG------GATAGGSQAAAAAGAEPME----
J9Z4N4_E1B19K-02        --------TVVFRPPGNNTDG----GAAAAAGGSQAAAAAGAEPME----
T1UG63_E1B19K-02        --------TVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAAGAEPME----
J7I6T8_E1B19K-02        --------TVVFRPPGNNTDG--GAAAAAAAGGSQAAAAAGAEPME----
J9Z4H6_E1B19K-02        --------TVVFRPPGNNTDGRAAAAAAAAAGGSQAAAAAGAEPME----
A0A7D0TLU2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-VAFLSFIKDKWSEETHLSGGYLLDFLAM
A0A0G2R248_E1B19K-      --------TVVFRPPGDNTDG-GAA---AAAGGSQ-AAAAGAEPME----
E1ARN8_E1B19K-02        --------TVVFRPPGNNTDG-GAAAATAAAGGSQAAAAAGAEPME----
E1ARN8_E1B19K-04        MEPE--------SRPGPSG-------------------------------
E1ARN8_E1B19K-03        MEPE--------SRPGPSG-------------------------------
A0A3Q9HK00_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HK78_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SPV1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WGT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SND6_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SP19_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A291P1B2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J9Z5H0_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
T1UG63_E1B19K-01        LFQEKVIKTLDFSTPGRTAAA-----------------------------
J9Z4N4_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJZ5_E1B19K-      LFQEKVIKTLDFSTPGRVAAA-----------------------------
A0A7L4WG90_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J9Z4H6_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A6M4W5T4_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WIG2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
J7I6T8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WK62_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SNH4_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A0G2R248_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJ54_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7D0TN91_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SSS2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3S9SNY0_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A2H4PJ75_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HJ63_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WIC2_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A7L4WJT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
A0A3Q9HLF7_E1B19K-      LFQEKVIKTLDFSTPGRAAAA-----------------------------
E1ARN8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAA-----------------------------
                                      **                                  

J9Z5H0_E1B19K-02        -----------------------------PESRP----------------
J9Z4N4_E1B19K-02        -----------------------------PESRP----------------
T1UG63_E1B19K-02        -----------------------------PESRP----------------
J7I6T8_E1B19K-02        -----------------------------PESRP----------------
J9Z4H6_E1B19K-02        -----------------------------PESRP----------------
A0A7D0TLU2_E1B19K-      HLWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYLQSG
A0A0G2R248_E1B19K-      -----------------------------PESRP----------------
E1ARN8_E1B19K-02        -----------------------------PESRP----------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEARNL
J9Z4N4_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
T1UG63_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
J7I6T8_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
J9Z4H6_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
A0A7D0TLU2_E1B19K-      LDPRKCHLVHIPQWPPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
A0A0G2R248_E1B19K-      -GPSGMNVVQVAELYPELRRILTITEDGQGLKGVKRERGACEATEEARNL
E1ARN8_E1B19K-02        -GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNL
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J9Z4N4_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
T1UG63_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J7I6T8_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
J9Z4H6_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
A0A7D0TLU2_E1B19K-      TFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
A0A0G2R248_E1B19K-      AFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
E1ARN8_E1B19K-02        TFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFE
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J9Z4N4_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
T1UG63_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J7I6T8_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
J9Z4H6_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
A0A7D0TLU2_E1B19K-      EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
A0A0G2R248_E1B19K-      EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
E1ARN8_E1B19K-02        EAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRC
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        ------------------------------------------------MN
A0A3Q9HK00_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HK78_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SPV1_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WGT1_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SND6_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SP19_E1B19K-      ---------------------------------------------VAFLS
A0A291P1B2_E1B19K-      ---------------------------------------------VAFLS
J9Z5H0_E1B19K-01        ---------------------------------------------VAFLS
T1UG63_E1B19K-01        ---------------------------------------------VAFLS
J9Z4N4_E1B19K-01        ---------------------------------------------VAFLS
A0A3Q9HJZ5_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WG90_E1B19K-      ---------------------------------------------VAFLS
J9Z4H6_E1B19K-01        ---------------------------------------------VAFLS
A0A6M4W5T4_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WIG2_E1B19K-      ---------------------------------------------VAFLS
J7I6T8_E1B19K-01        ---------------------------------------------VAFLS
A0A7L4WK62_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SNH4_E1B19K-      ---------------------------------------------VAFLS
A0A0G2R248_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HJ54_E1B19K-      ---------------------------------------------VAFLS
A0A7D0TN91_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SSS2_E1B19K-      ---------------------------------------------VAFLS
A0A3S9SNY0_E1B19K-      ---------------------------------------------VAFLS
A0A2H4PJ75_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HJ63_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WIC2_E1B19K-      ---------------------------------------------VAFLS
A0A7L4WJT1_E1B19K-      ---------------------------------------------VAFLS
A0A3Q9HLF7_E1B19K-      ---------------------------------------------VAFLS
E1ARN8_E1B19K-01        ---------------------------------------------VAFLS
                                                                          

J9Z5H0_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
J9Z4N4_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
T1UG63_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
J7I6T8_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
J9Z4H6_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
A0A7D0TLU2_E1B19K-      SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGPGFHRFVN
A0A0G2R248_E1B19K-      SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
E1ARN8_E1B19K-02        SMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNN
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        VVQPESMSKVNLNGVFD---------------------------------
A0A3Q9HK00_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3Q9HK78_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SPV1_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WGT1_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SND6_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SP19_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A291P1B2_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
J9Z5H0_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
T1UG63_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
J9Z4N4_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
A0A3Q9HJZ5_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WG90_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
J9Z4H6_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
A0A6M4W5T4_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WIG2_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
J7I6T8_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WK62_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SNH4_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A0G2R248_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3Q9HJ54_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7D0TN91_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SSS2_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3S9SNY0_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A2H4PJ75_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3Q9HJ63_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WIC2_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A7L4WJT1_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
A0A3Q9HLF7_E1B19K-      FIKDKWSEETHLSGGYLLDF------------------------------
E1ARN8_E1B19K-01        FIKDKWSEETHLSGGYLLDF------------------------------
                                                                          

J9Z5H0_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
J9Z4N4_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
T1UG63_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
J7I6T8_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
J9Z4H6_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
A0A7D0TLU2_E1B19K-      TCIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
A0A0G2R248_E1B19K-      TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
E1ARN8_E1B19K-02        TCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
J9Z4N4_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
T1UG63_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
J7I6T8_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
J9Z4H6_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
A0A7D0TLU2_E1B19K-      SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEALSSQLPTTMLCINHSL
A0A0G2R248_E1B19K-      SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
E1ARN8_E1B19K-02        SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLL
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
J9Z4N4_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
T1UG63_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
J7I6T8_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
J9Z4H6_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
A0A7D0TLU2_E1B19K-      KIIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
A0A0G2R248_E1B19K-      KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
E1ARN8_E1B19K-02        KTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLE
E1ARN8_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
                                                                          

J9Z5H0_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
J9Z4N4_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
T1UG63_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
J7I6T8_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
J9Z4H6_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
A0A7D0TLU2_E1B19K-      PMVMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
A0A0G2R248_E1B19K-      PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
E1ARN8_E1B19K-02        PESMSKVNLNGVFDMTMKIWKVLRYDETR----TRCRPCECGGKH-----
E1ARN8_E1B19K-04        --------------------------------MNVVQEGGVPTL------
E1ARN8_E1B19K-03        --------------MTMKIWKVLRYDETR----TRCRPCECGGKH-----
A0A3Q9HK00_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3Q9HK78_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3S9SPV1_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQ
A0A7L4WGT1_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3S9SND6_E1B19K-      --------------LAMHLWRAVVRHKNRMLLLSSVRPAIIPTEE-----
A0A3S9SP19_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A291P1B2_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
J9Z5H0_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
T1UG63_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
J9Z4N4_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3Q9HJZ5_E1B19K-      --------------LAMHLWRAVVRHKNGLLLLSSVRPAIIPTEE-----
A0A7L4WG90_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE---QQ
J9Z4H6_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A6M4W5T4_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A7L4WIG2_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
J7I6T8_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A7L4WK62_E1B19K-      --------------LAMHLWRAVVRHKNRMLLLSSVRPAIIRTEE-----
A0A3S9SNH4_E1B19K-      --------------LAMHLWRAVVRHKNRMLLLSSVRPAIIPTEE-----
A0A0G2R248_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3Q9HJ54_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A7D0TN91_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3S9SSS2_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIPTEEQ-----
A0A3S9SNY0_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVSPAIIPTEE-----
A0A2H4PJ75_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
A0A3Q9HJ63_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE----Q
A0A7L4WIC2_E1B19K-      --------------LAMHLWRAVVRHKNRLILLSSVRPAIIPTEQ----Q
A0A7L4WJT1_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--QQQ
A0A3Q9HLF7_E1B19K-      --------------LAMHLWRAVVRHKNRLLLLSSVSPAIIPTEE-----
E1ARN8_E1B19K-01        --------------LAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-----
                                                         .                

J9Z5H0_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J9Z4N4_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
T1UG63_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J7I6T8_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
J9Z4H6_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A7D0TLU2_E1B19K-      -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A0G2R248_E1B19K-      -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
E1ARN8_E1B19K-02        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
E1ARN8_E1B19K-04        ------------------------------PMQFESH
E1ARN8_E1B19K-03        -IRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
A0A3Q9HK00_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3Q9HK78_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SPV1_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A7L4WGT1_E1B19K-      ----------EARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SND6_E1B19K-      --QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SP19_E1B19K-      ------QQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A291P1B2_E1B19K-      ------QQQEEARRRRRQEQSPWNPRAGLDPRE----
J9Z5H0_E1B19K-01        ------QQQEEARRRRRQEQSPWNPRAGLDPRE----
T1UG63_E1B19K-01        QQQQQQQQEEARRRRRRQEQSPWNPRAGLDPRE----
J9Z4N4_E1B19K-01        ----QQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3Q9HJZ5_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A7L4WG90_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
J9Z4H6_E1B19K-01        QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A6M4W5T4_E1B19K-      --QQQQQQQEETRRRRRQEQSPWNPRAGLDPRE----
A0A7L4WIG2_E1B19K-      --QQQQQLQEEARRRRRQEQSPWNPRAGLDPRE----
J7I6T8_E1B19K-01        --QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A7L4WK62_E1B19K-      ---QQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SNH4_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A0G2R248_E1B19K-      -----QQQQQEEARRRRQEQSPWNPRAGLDPRE----
A0A3Q9HJ54_E1B19K-      -----QQQEEARRRRRRQEQSPWNPRAGLDPRE----
A0A7D0TN91_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SSS2_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3S9SNY0_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A2H4PJ75_E1B19K-      ---QQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3Q9HJ63_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A7L4WIC2_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A7L4WJT1_E1B19K-      QQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
A0A3Q9HLF7_E1B19K-      -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
E1ARN8_E1B19K-01        -QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE----
                                                      . :    

© 1998-2022Legal notice