Dataset for protein adenoviridae of organism Human mastadenovirus C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             **:*******************************.*******:********
-----------------------------MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
mfnlhgvlngaglkgyimrrglilvtfdl  t                               c       v        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:***********************************.******************************************
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
 d                                   v                                          
                                     t                                          

       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
 :****** *** . *:           **::   ********************
RLLLLSSVRPAIIPTEE------qqqqqQQQEEaRRRRRQEQSPWNPRAGLDPRE
gm      s   pte qqqqqqq-----  eqara                    
                                 e                     
© 1998-2020Legal notice