Dataset for protein adenoviridae of organism Human mastadenovirus C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
        y t  l h          s    t       mer  ps rgvpag---- ---------    v     fsg
                                                      ktk v ls c p              

        90       100       110       120       130       140       150       160
   ::*  *  :*               *: * .**  : .                                       
-asve gc tqe pa------------- vv rp  nntdgrgaaaaaaaaggsqaaaaagaepmeflamhlwravvrhk
hdf         t                     dv   gagflstitgkwqeethls gylld              
                                     t    v  g g kd s a                         

       170       180       190       200       210       220       230       240
                    qnh                  d rkchl hipqwy         t               

       250       260       270       280       290       300       310       320
c     a   a  fkispla pisg                                                       

       330       340       350       360       370       380       390       400
                          *  .      .      *   ::                    :          
klvnirnccyisgngaeveidtedrg arcsminmgpgvlgmd vvimnpesrpgpvrftgpnfsgtvtvpntnlilhgv
                            aataaag  qaaaaa aep e       sgmnvvqpgsvsk n        p
                                                               ee mp            

       410       420       430       440       450       460       470       480
g hr v   i             l--v--mt----                                             
                        ng fd  mkiw                                             

       490       500       510       520       530       540       550       560
          als  lp tmlcin s  i                                                 mv

       570       580       590       600       610       620       630      
                                                                   : .      
                 -mi----------t- q  qqqhir- -----ar--- ---------  q e h-    
                 g-          pre -            leq--a                        
© 1998-2022Legal notice