Dataset for protein adenoviridae of organism Human mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q9HK78_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A3S9SPV1_E1B19K-      MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSS
A0A7L4WGT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SND6_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SP19_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A291P1B2_E1B19K-      -----------------------------METWECLEDFSAVRNLLEQSS
T1UG63_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A8F9W8V2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLKQSS
A0A3Q9HJZ5_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WG90_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIG2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
J7I6T8_E1B19K-01        -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WK62_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7D0TN91_E1B19K-      -----------------MRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A3Q9HJ54_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNH4_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SSS2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A3S9SNY0_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A2H4PJ75_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WIC2_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7L4WJT1_E1B19K-      -----------------------------MEAWECLEDFSAVRNLLEQSS
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
J7I6T8_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
                                                                          

A0A3Q9HK78_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SPV1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WGT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SND6_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SP19_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQA
A0A291P1B2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
T1UG63_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A8F9W8V2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJZ5_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WG90_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIG2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J7I6T8_E1B19K-01        NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WK62_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7D0TN91_E1B19K-      NSTSWFWRVLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3Q9HJ54_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNH4_E1B19K-      NSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SSS2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A3S9SNY0_E1B19K-      NSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A2H4PJ75_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WIC2_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7L4WJT1_E1B19K-      NSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGH--------------ASVESGGETQESPA-----
                        :  .   * : .. . :                ::* **  :*       

A0A3Q9HK78_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SPV1_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WGT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SND6_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SP19_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A291P1B2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
T1UG63_E1B19K-01        LFQEKVIKTLDFSTPGRTAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A8F9W8V2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HJZ5_E1B19K-      LFQEKVIKTLDFSTPGRVAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WG90_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WIG2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J7I6T8_E1B19K-01        LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WK62_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7D0TN91_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3Q9HJ54_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SNH4_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SSS2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A3S9SNY0_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A2H4PJ75_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WIC2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7L4WJT1_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
A0A7D0TLU2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMH
J7I6T8_E1B19K-02        --------TVVFRPPGNNTDGGAAAAAAAGGSQ--AAAAAG---------
T1UG63_E1B19K-02        --------TVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAAG---------
                                *: * .**. : . *  :      .  :  :.*         

A0A3Q9HK78_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE-----------------------
A0A3S9SPV1_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQ-----------------
A0A7L4WGT1_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
A0A3S9SND6_E1B19K-      LWRAVVRHKNRMLLLSSVRPAIIPTE---E--------------------
A0A3S9SP19_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
A0A291P1B2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
T1UG63_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTE---E--Q-----------------
A0A8F9W8V2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
A0A3Q9HJZ5_E1B19K-      LWRAVVRHKNGLLLLSSVRPAIIPTE---E--Q-----------------
A0A7L4WG90_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---EQQQ-----------------
A0A7L4WIG2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
J7I6T8_E1B19K-01        LWRAVVRHKNRLLLLSSVRPAIIPTE---E--------------------
A0A7L4WK62_E1B19K-      LWRAVVRHKNRMLLLSSVRPAIIRTE------------------------
A0A7D0TN91_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE------E-----------------
A0A3Q9HJ54_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE------------------------
A0A3S9SNH4_E1B19K-      LWRAVVRHKNRMLLLSSVRPAIIPTE------E-----------------
A0A3S9SSS2_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIPTEE------Q-----------------
A0A3S9SNY0_E1B19K-      LWRAVVRHKNRLLLLSSVSPAIIPTE------E-----------------
A0A2H4PJ75_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTE------------------------
A0A7L4WIC2_E1B19K-      LWRAVVRHKNRLILLSSVRPAIIPTE----QQQ-----------------
A0A7L4WJT1_E1B19K-      LWRAVVRHKNRLLLLSSVRPAIIPTEE--QQQQ-----------------
A0A7D0TLU2_E1B19K-      LWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYLQSGL
J7I6T8_E1B19K-02        -----------------------AEPMEPESRP-----------------
T1UG63_E1B19K-02        -----------------------AEPMEPESRP-----------------
                                                                          

A0A3Q9HK78_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A3S9SPV1_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A7L4WGT1_E1B19K-      -------------------------------EARRRRRQEQSP-------
A0A3S9SND6_E1B19K-      -----------------------QQQQQQQEEARRRRRQEQSP-------
A0A3S9SP19_E1B19K-      ---------------------------QQQEEARRRRRQEQSP-------
A0A291P1B2_E1B19K-      ---------------------------QQQEEARRRRRQEQSP-------
T1UG63_E1B19K-01        ----------------------QQQQQQQEEARRRRRRQEQSP-------
A0A8F9W8V2_E1B19K-      ---------------------------QQQEEARRRRRQEQSP-------
A0A3Q9HJZ5_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A7L4WG90_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A7L4WIG2_E1B19K-      -----------------------QQQQQLQEEARRRRRQEQSP-------
J7I6T8_E1B19K-01        -----------------------QQQQQQQEEARRRRRQEQSP-------
A0A7L4WK62_E1B19K-      -----------------------EQQQQQQEEARRRRRQEQSP-------
A0A7D0TN91_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A3Q9HJ54_E1B19K-      -------------------------EQQQEEARRRRRRQEQSP-------
A0A3S9SNH4_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A3S9SSS2_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A3S9SNY0_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A2H4PJ75_E1B19K-      -----------------------EQQQQQQEEARRRRRQEQSP-------
A0A7L4WIC2_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A7L4WJT1_E1B19K-      ----------------------QQQQQQQQEEARRRRRQEQSP-------
A0A7D0TLU2_E1B19K-      DPRKCHLVHIPQWPPELRRILTINEDGQGLKGVKRERGASEATEEVRNLT
J7I6T8_E1B19K-02        GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLT
T1UG63_E1B19K-02        GPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLT
                                                         .* *  .::.       

A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A7D0TLU2_E1B19K-      FSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
J7I6T8_E1B19K-02        FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
T1UG63_E1B19K-02        FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
                                                                          

A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A7D0TLU2_E1B19K-      AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
J7I6T8_E1B19K-02        AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
T1UG63_E1B19K-02        AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
                                                                          

A0A3Q9HK78_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SPV1_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7L4WGT1_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SND6_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SP19_E1B19K-      ----WNPRAGLD--------------------------------------
A0A291P1B2_E1B19K-      ----WNPRAGLD--------------------------------------
T1UG63_E1B19K-01        ----WNPRAGLD--------------------------------------
A0A8F9W8V2_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3Q9HJZ5_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7L4WG90_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7L4WIG2_E1B19K-      ----WNPRAGLD--------------------------------------
J7I6T8_E1B19K-01        ----WNPRAGLD--------------------------------------
A0A7L4WK62_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7D0TN91_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3Q9HJ54_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SNH4_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SSS2_E1B19K-      ----WNPRAGLD--------------------------------------
A0A3S9SNY0_E1B19K-      ----WNPRAGLD--------------------------------------
A0A2H4PJ75_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7L4WIC2_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7L4WJT1_E1B19K-      ----WNPRAGLD--------------------------------------
A0A7D0TLU2_E1B19K-      MINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGPGFHRFVNT
J7I6T8_E1B19K-02        MINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNT
T1UG63_E1B19K-02        MINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNT
                            *    *:*                                      

A0A3Q9HK78_E1B19K-      -------------------------PRE----------------------
A0A3S9SPV1_E1B19K-      -------------------------PRE----------------------
A0A7L4WGT1_E1B19K-      -------------------------PRE----------------------
A0A3S9SND6_E1B19K-      -------------------------PRE----------------------
A0A3S9SP19_E1B19K-      -------------------------PRE----------------------
A0A291P1B2_E1B19K-      -------------------------PRE----------------------
T1UG63_E1B19K-01        -------------------------PRE----------------------
A0A8F9W8V2_E1B19K-      -------------------------PRE----------------------
A0A3Q9HJZ5_E1B19K-      -------------------------PRE----------------------
A0A7L4WG90_E1B19K-      -------------------------PRE----------------------
A0A7L4WIG2_E1B19K-      -------------------------PRE----------------------
J7I6T8_E1B19K-01        -------------------------PRE----------------------
A0A7L4WK62_E1B19K-      -------------------------PRE----------------------
A0A7D0TN91_E1B19K-      -------------------------PRE----------------------
A0A3Q9HJ54_E1B19K-      -------------------------PRE----------------------
A0A3S9SNH4_E1B19K-      -------------------------PRE----------------------
A0A3S9SSS2_E1B19K-      -------------------------PRE----------------------
A0A3S9SNY0_E1B19K-      -------------------------PRE----------------------
A0A2H4PJ75_E1B19K-      -------------------------PRE----------------------
A0A7L4WIC2_E1B19K-      -------------------------PRE----------------------
A0A7L4WJT1_E1B19K-      -------------------------PRE----------------------
A0A7D0TLU2_E1B19K-      CIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
J7I6T8_E1B19K-02        CVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
T1UG63_E1B19K-02        CVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
                                                 *..                      

A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A7D0TLU2_E1B19K-      RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEALSSQLPTTMLCINHSLK
J7I6T8_E1B19K-02        RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLK
T1UG63_E1B19K-02        RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLK
                                                                          

A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A7D0TLU2_E1B19K-      IIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEP
J7I6T8_E1B19K-02        TIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEP
T1UG63_E1B19K-02        TIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEP
                                                                          

A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A7D0TLU2_E1B19K-      MVMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDV
J7I6T8_E1B19K-02        ESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDV
T1UG63_E1B19K-02        ESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDV
                                                                          

A0A3Q9HK78_E1B19K-      --------------------------
A0A3S9SPV1_E1B19K-      --------------------------
A0A7L4WGT1_E1B19K-      --------------------------
A0A3S9SND6_E1B19K-      --------------------------
A0A3S9SP19_E1B19K-      --------------------------
A0A291P1B2_E1B19K-      --------------------------
T1UG63_E1B19K-01        --------------------------
A0A8F9W8V2_E1B19K-      --------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------
A0A7L4WG90_E1B19K-      --------------------------
A0A7L4WIG2_E1B19K-      --------------------------
J7I6T8_E1B19K-01        --------------------------
A0A7L4WK62_E1B19K-      --------------------------
A0A7D0TN91_E1B19K-      --------------------------
A0A3Q9HJ54_E1B19K-      --------------------------
A0A3S9SNH4_E1B19K-      --------------------------
A0A3S9SSS2_E1B19K-      --------------------------
A0A3S9SNY0_E1B19K-      --------------------------
A0A2H4PJ75_E1B19K-      --------------------------
A0A7L4WIC2_E1B19K-      --------------------------
A0A7L4WJT1_E1B19K-      --------------------------
A0A7D0TLU2_E1B19K-      TEELRPDHLVLACTRAEFGSSDEDTD
J7I6T8_E1B19K-02        TEELRPDHLVLACTRAEFGSSDEDTD
T1UG63_E1B19K-02        TEELRPDHLVLACTRAEFGSSDEDTD
                                                  

© 1998-2022Legal notice