Dataset for protein adenoviridae of organism Human mastadenovirus C

[Download (right click)] [Alignment] [Repertoires]

21 sequence(s)

>gnl|bcl2dbpro|A0A0G2R248_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A291P1B2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
METWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A2H4PJ75_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=178 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQEEARRR
RRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ54_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQEE
ARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJZ5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRVAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNGLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK00_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=210 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK78_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=209 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HLF7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SND6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNH4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNY0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SP19_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SPV1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=215 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SSS2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIPTEEQQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1ARN8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J7I6T8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4H6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4N4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=177 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
RQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z5H0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|T1UG63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRTAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRRQEQSPWNPRAGLDPRE
© 1998-2020Legal notice