Dataset for protein adenoviridae of organism Human adenovirus sp

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:    * :                                                                       
MevweiLed-----------------------------------------------------------------------
 dapac qqgirfgfhsssfvenmegsqdednlkllasaasrssrdtetptdhasgsaggaaggqsesrpgpsgggvadl
  p ts a                                                                        
    n                                                                           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   * ::  :: .                                                                  
fsktRnlleqssds------------------------------------------------------------------
lrav rvvtnatnggqnrgikrernpsgnnsrtelalslmsrrrpetvwwhevqsegrdevsilqekysleqlktcwlep
 pql q   r  t                                                                   
  e  l   d                                                                      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           :*    .     ::   .. *
--------------------------------------------------------vsgfWrfwfgssqarlv-frikqD
eddwevairnyakislrpdkqyritkkinirnacyisgngaeviidtqdkaafrcctmwm phlwatelvkvmnctvre 
                                                        m  l  gvv mpist   y k 
                                                        c         gda     i   g 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  : : :: ..                                           :::  ***     : .:  
------ykwefekllkdcp-----------------------------------------glfeslNLGhqalfqekvls
gyngivfsentkeifvssgffgfnntcveawgqvsvrgcsfyacwiatsgrvksqlsvkkemldac   ilvhgkariik
       nv   n  hs                                         c        se e   rh
       ma   l  d                                                       n        
               a                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .:                                    .  * * :: .  .**    :              * .
vldfst----------------------------------pgrtaAaVaflsfildKWseqthl-----------srGyv
taatesgcfilikgnasvkhnmicghsderpyqmltcagghcnat t hivthlkk  ipeeqfvitkctmhiggrg ml
s                                          il g    v av   pvn  n            k  i
c                                                     r    rf                  f
                                                           q                    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :                              **.       .  :                 .               
ldf--------------------------lamhLWrawvrrknrtillywv-----------rppvmptvlqeeqqeq--
mpyqcnmnhvkvmlepdafsrvsltgifdvnta  ktvkvhrmqllvnsspvqplgvagilrhqaiivaeeeqqr-qdqq
                             m iq   ilryqdtkrr gacl    cggkha i  tc glt----p-smv
                             i a       ad g  r  e           f  aa d  rll  thll
                             a                                        dh  d   

       490       500         
....:....|....:....|....:....
               . : :..       
ee------------npragldppvee---
--arrrrrqeqspwctgsefgsre--aen
laem qamd             ss  tl 
                       g  ed 
                             
© 1998-2022Legal notice