Dataset for protein adenoviridae of organism Human adenovirus sp

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A1Y1BYF1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|A0A513TZR1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYI9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYM9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A5P8KYF0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A5P8KYF0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|A0A7U3S1T6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASEIARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|A0A7U3S224_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
© 1998-2022Legal notice