Dataset for protein adenoviridae of organism Human adenovirus sp

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5P8KYF0_E1B19K-      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETP
A0A5P8KYF0_E1B19K-      MEVWAILED-----------------------------------------
A0A7U3S1T6_E1B19K-      MEVWAILED-----------------------------------------
A0A7U3S224_E1B19K-      MEVWAILED-----------------------------------------
A0A1Y1BYF1_E1B19K-      MDVWTILAD-----------------------------------------
A0A516UYI9_E1B19K-      MEAWECLED-----------------------------------------
A0A513TZR1_E1B19K-      MEAWECLED-----------------------------------------
A0A516UYM9_E1B19K-      MEAWECLED-----------------------------------------
                        *:    * :                                         

A0A5P8KYF0_E1B19K-      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
A0A5P8KYF0_E1B19K-      ------------------------------LRQTRLLLENASDG------
A0A7U3S1T6_E1B19K-      ------------------------------LRKTRQLLENASDG------
A0A7U3S224_E1B19K-      ------------------------------LRKTRQLLENASDG------
A0A1Y1BYF1_E1B19K-      ------------------------------FSKTRRLVEDSSDG------
A0A516UYI9_E1B19K-      ------------------------------FSAVRNLLEQSSNS------
A0A513TZR1_E1B19K-      ------------------------------FSAVRNLLEQSSNS------
A0A516UYM9_E1B19K-      ------------------------------FSAVRNLLEQSSNS------
                                                      :   * ::  :: .      

A0A5P8KYF0_E1B19K-      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
A0A5P8KYF0_E1B19K-      --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
                                                                          

A0A5P8KYF0_E1B19K-      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
A0A5P8KYF0_E1B19K-      --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
                                                                          

A0A5P8KYF0_E1B19K-      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
A0A5P8KYF0_E1B19K-      ----------------VSGLWRFWFGGDLARLV-FRIKQD------YSVE
A0A7U3S1T6_E1B19K-      ----------------VSGFWRFWFASEIARVV-FRIKQD------YKEE
A0A7U3S224_E1B19K-      ----------------VSGFWRFWFASELARVV-FRIKQD------YKEE
A0A1Y1BYF1_E1B19K-      ----------------CSGFWRHWFGTPLSRLV-YTVKKD------YNEE
A0A516UYI9_E1B19K-      ----------------TSWFWRFLWGSSQAKLV-CRIKED------YKWE
A0A513TZR1_E1B19K-      ----------------TSWFWRFLWGSSQAKLV-CRIKED------YKWE
A0A516UYM9_E1B19K-      ----------------TSWFWRFLWGSSQAKLV-CRIKED------YKWE
                                           :*    .     ::   .. *      :  :

A0A5P8KYF0_E1B19K-      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A5P8KYF0_E1B19K-      FEKLLDDSP-----------------------------------------
A0A7U3S1T6_E1B19K-      FEKLLVDCP-----------------------------------------
A0A7U3S224_E1B19K-      FEKLLVDCP-----------------------------------------
A0A1Y1BYF1_E1B19K-      FENLFADCS-----------------------------------------
A0A516UYI9_E1B19K-      FEELLKSCG-----------------------------------------
A0A513TZR1_E1B19K-      FEELLKSCG-----------------------------------------
A0A516UYM9_E1B19K-      FEELLKSCG-----------------------------------------
                         : :: ..                                          

A0A5P8KYF0_E1B19K-      CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A5P8KYF0_E1B19K-      GLFEALNLGHQAHFKEKVLSVLDFST------------------------
A0A7U3S1T6_E1B19K-      GLFEALNLGHQVHFKEKVLSVLDFST------------------------
A0A7U3S224_E1B19K-      GLFEALNLGHQVHFKEKVLSVLDFST------------------------
A0A1Y1BYF1_E1B19K-      GLLDSLNLGHQSLFQERVLHSLDFSS------------------------
A0A516UYI9_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
A0A513TZR1_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
A0A516UYM9_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
                         :::  ***     : .:      .:                        

A0A5P8KYF0_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
A0A5P8KYF0_E1B19K-      ----------PGRTAAAVAFLTFILDKWIRQTHF-----------SKGYV
A0A7U3S1T6_E1B19K-      ----------PGRTAAAVAFLTFILDKWIPQTHF-----------SRGYV
A0A7U3S224_E1B19K-      ----------PGRTAAAVAFLTFILDKWIPQTHF-----------SRGYV
A0A1Y1BYF1_E1B19K-      ----------PGRTTAGVAFVVFLVDKWSQNTQL-----------SRGYI
A0A516UYI9_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
A0A513TZR1_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
A0A516UYM9_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
                                    .  * * :: .  .**    :              * .

A0A5P8KYF0_E1B19K-      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
A0A5P8KYF0_E1B19K-      LDF--------------------------IAAALWRTWKARRMRTILNYW
A0A7U3S1T6_E1B19K-      LDF--------------------------VATALWRTWKVRKMRTILGYW
A0A7U3S224_E1B19K-      LDF--------------------------VATALWRTWKVRKMRTILGYW
A0A1Y1BYF1_E1B19K-      LDF--------------------------AAMHLWRAWVRQRGQRILNYW
A0A516UYI9_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRLLLLSS
A0A513TZR1_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRMLLLSS
A0A516UYM9_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRLLLLSS
                        : :                              **.       .  :   

A0A5P8KYF0_E1B19K-      E----CGGKHARFQPVCVDVTEDLRPDHLVLA------------CTGAEF
A0A5P8KYF0_E1B19K-      PVQPLGVAGILRHPPTMPAVLQEEQQED----------------NPRAGL
A0A7U3S1T6_E1B19K-      PVQPLGVAGILRHPPVMPAVLEEEQQED----------------NPRAGL
A0A7U3S224_E1B19K-      PVQPLGVAGILRHPPVMPAVLEEEQQED----------------NPRAGL
A0A1Y1BYF1_E1B19K-      L-----------IQPAAPGLLRLHRQTSMLEEEMRQAMDE----NPRSGL
A0A516UYI9_E1B19K-      V-----------RPAIIPTEE------QQQEEARRRRRQEQSPWNPRAGL
A0A513TZR1_E1B19K-      V-----------RPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGL
A0A516UYM9_E1B19K-      V-----------RPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGL
                                      .                              . : :

A0A5P8KYF0_E1B19K-      GSSGEETD-
A0A5P8KYF0_E1B19K-      DPPVEE---
A0A7U3S1T6_E1B19K-      DPPVEEAE-
A0A7U3S224_E1B19K-      DPPVEEAE-
A0A1Y1BYF1_E1B19K-      DPPSEEELN
A0A516UYI9_E1B19K-      DPRE-----
A0A513TZR1_E1B19K-      DPRE-----
A0A516UYM9_E1B19K-      DPRE-----
                        ..       

© 1998-2022Legal notice