Dataset for protein adenoviridae of organism Human adenovirus sp

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5P8KYF0_E1B19K-      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETP
A0A5P8KYF0_E1B19K-      MEVWAILED-----------------------------------------
A0A1Y1BYF1_E1B19K-      MDVWTILAD-----------------------------------------
A0A516UYI9_E1B19K-      MEAWECLED-----------------------------------------
A0A513TZR1_E1B19K-      MEAWECLED-----------------------------------------
A0A516UYM9_E1B19K-      MEAWECLED-----------------------------------------
                        *:    * :                                         

A0A5P8KYF0_E1B19K-      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
A0A5P8KYF0_E1B19K-      ------------------------------LRQTRLLLENASDGVSG---
A0A1Y1BYF1_E1B19K-      ------------------------------FSKTRRLVEDSSDGCSG---
A0A516UYI9_E1B19K-      ------------------------------FSAVRNLLEQSSNSTSW---
A0A513TZR1_E1B19K-      ------------------------------FSAVRNLLEQSSNSTSW---
A0A516UYM9_E1B19K-      ------------------------------FSAVRNLLEQSSNSTSW---
                                                      :   * ::  :: . .    

A0A5P8KYF0_E1B19K-      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
A0A5P8KYF0_E1B19K-      ---------------------------LWRFWFGGDLARLVFRIKQDYSV
A0A1Y1BYF1_E1B19K-      ---------------------------FWRHWFGTPLSRLVYTVKKDYNE
A0A516UYI9_E1B19K-      ---------------------------FWRFLWGSSQAKLVCRIKEDYKW
A0A513TZR1_E1B19K-      ---------------------------FWRFLWGSSQAKLVCRIKEDYKW
A0A516UYM9_E1B19K-      ---------------------------FWRFLWGSSQAKLVCRIKEDYKW
                                                   .*..         *  :::.*. 

A0A5P8KYF0_E1B19K-      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
A0A5P8KYF0_E1B19K-      E-------------------------------------------------
A0A1Y1BYF1_E1B19K-      E-------------------------------------------------
A0A516UYI9_E1B19K-      E-------------------------------------------------
A0A513TZR1_E1B19K-      E-------------------------------------------------
A0A516UYM9_E1B19K-      E-------------------------------------------------
                        *                                                 

A0A5P8KYF0_E1B19K-      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
A0A5P8KYF0_E1B19K-      --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
                                                                          

A0A5P8KYF0_E1B19K-      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A5P8KYF0_E1B19K-      -----------------------------------------FEKLLDDSP
A0A1Y1BYF1_E1B19K-      -----------------------------------------FENLFADCS
A0A516UYI9_E1B19K-      -----------------------------------------FEELLKSCG
A0A513TZR1_E1B19K-      -----------------------------------------FEELLKSCG
A0A516UYM9_E1B19K-      -----------------------------------------FEELLKSCG
                                                                 .:. :    

A0A5P8KYF0_E1B19K-      CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A5P8KYF0_E1B19K-      GLFEALNLGHQAHFKEKVLSVLDFST------------------------
A0A1Y1BYF1_E1B19K-      GLLDSLNLGHQSLFQERVLHSLDFSS------------------------
A0A516UYI9_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
A0A513TZR1_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
A0A516UYM9_E1B19K-      ELFDSLNLGHQALFQEKVIKTLDFST------------------------
                         :::  ***     : .:      .:                        

A0A5P8KYF0_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
A0A5P8KYF0_E1B19K-      ----------PGRTAAAVAFLTFILDKWIRQTHF-----------SKGYV
A0A1Y1BYF1_E1B19K-      ----------PGRTTAGVAFVVFLVDKWSQNTQL-----------SRGYI
A0A516UYI9_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
A0A513TZR1_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
A0A516UYM9_E1B19K-      ----------PGRAAAAVAFLSFIKDKWSEETHL-----------SGGYL
                                    .  * * :: .  .**    :              * .

A0A5P8KYF0_E1B19K-      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKP-----
A0A5P8KYF0_E1B19K-      LDF--------------------------IAAALWRTWKARRMRTILNYW
A0A1Y1BYF1_E1B19K-      LDF--------------------------AAMHLWRAWVRQRGQRILNYW
A0A516UYI9_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRLLLLSS
A0A513TZR1_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRMLLLSS
A0A516UYM9_E1B19K-      LDF--------------------------LAMHLWRAVVRHKNRLLLLSS
                        : :                              **.       .      

A0A5P8KYF0_E1B19K-      ------------RVRACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAE
A0A5P8KYF0_E1B19K-      PVQPLGVAGILRHPPTMPAVLQEEQQED----------------NPRAGL
A0A1Y1BYF1_E1B19K-      L-----------IQPAAPGLLRLHRQTSMLEEEMRQAMDE----NPRSGL
A0A516UYI9_E1B19K-      V-----------RPAIIPTEE------QQQEEARRRRRQEQSPWNPRAGL
A0A513TZR1_E1B19K-      V-----------RPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGL
A0A516UYM9_E1B19K-      V-----------RPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGL
                                                                       .. 

A0A5P8KYF0_E1B19K-      FGSSGEETD
A0A5P8KYF0_E1B19K-      DPPVEE---
A0A1Y1BYF1_E1B19K-      DPPSEEELN
A0A516UYI9_E1B19K-      DPRE-----
A0A513TZR1_E1B19K-      DPRE-----
A0A516UYM9_E1B19K-      DPRE-----
                                 

© 1998-2020Legal notice