Dataset for protein E1B 19K of organism Human adenovirus B serotype 3

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :*     :*  : .** . **                                 .**:.:
--------------------mEvwaileDlrqtrLLlenAS---------------------------------dGVsgl
mdppnslqqgirfgfhsssfv nmegsq ednlk  asa  gssrdtetptdhasgsaggaaggqsesrpgpsgg  adf
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:                                               :*.                             
wr----------------------------------------------fWfg----------------------------
fpelrrvltrsttsgqnrgikrernpsgnnsrtelalslmsrrrpetvw hevqsegrdevsilqekysleqlktcwlep
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : *.: :* .::**               :  * ::* :. . * .  :* . . .  :.::::::   * 
--------gdlArlvfRikqdYR---------------eefEkllD-dspglFealnlG-hqahfkekvlsvldfstpGr
eddwevairny kisl pdkq  itkkinirnacyisgnga vii tqdkav rccmm mwpgvvgmeavtlmnirfr d
                                                   a                         k  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .:.*:                   :: *    :*   *   ::                                  
taaavaFlt----------------fildkW----iRqthFskgyvld--------------------------------
gyngiv mantklilhgcsffgfnntcvea gqvsv gcs yacwiatsgrvksqlsvkkcmfercnlgilnegearvrh
        i                                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                .*.:  ...*                      
------------------------------------------------fIaaalwrtW----------------------
caatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvh vsharkk pvfehnvitkctmhiggrrgmf
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     : ..:..:*:  ... :.::**:        :*. :: : . **                               
-----karrmrtiLdywpvqplgvaGIlrhpptmpavLqeeqqednpRA-------------------------------
mpyqcnmnhvkvm epdafsrvslt  fdmniqlwki ryddtkprv  cecggkharfqpvcvdvtedlrpdhlvlact
                                -- v                                            

       490  
....:....|..
    * .    :
----Gldppvee
gaef ssgeetd
            
© 1998-2022Legal notice