Dataset for protein E1B 19K of organism Human adenovirus B serotype 3

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8B0L9Y2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=176 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPPAVLQEE
QQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A8B0LBX6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPVVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A8B0LCV0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A8B0LD36_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLIFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2Y0J3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTKLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2Y0J3_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
© 1998-2022Legal notice