Dataset for protein E1B 19K of organism Human adenovirus B serotype 3

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KSL3_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
Q2Y0J3_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
A0A8B0L9Y2_E1B19K-      --------------------MEVWAILEDLRQTRLLLENAS---------
A0A8B0LD36_E1B19K-      --------------------MEVWAILEDLRQTRLLLENAS---------
A0A8B0LCV0_E1B19K-      --------------------MEVWAILEDLRQTRLLLENAS---------
A0A8B0LBX6_E1B19K-      --------------------MEVWAILEDLRQTRLLLENAS---------
Q2KSL3_E1B19K-01        --------------------MEVWAILEDLRQTRLLLENAS---------
Q2Y0J3_E1B19K-01        --------------------MEVWAILEDLRQTKLLLENAS---------
                                            :*     :*  : .** . **         

Q2KSL3_E1B19K-02        TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
Q2Y0J3_E1B19K-02        TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
A0A8B0L9Y2_E1B19K-      ------------------------DGVSGLWR------------------
A0A8B0LD36_E1B19K-      ------------------------DGVSGLWR------------------
A0A8B0LCV0_E1B19K-      ------------------------DGVSGFWR------------------
A0A8B0LBX6_E1B19K-      ------------------------DGVSGLWR------------------
Q2KSL3_E1B19K-01        ------------------------DGVSGLWR------------------
Q2Y0J3_E1B19K-01        ------------------------DGVSGLWR------------------
                                                .**:.::                   

Q2KSL3_E1B19K-02        KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
Q2Y0J3_E1B19K-02        KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
A0A8B0L9Y2_E1B19K-      ----------------------------FWFG------------------
A0A8B0LD36_E1B19K-      ----------------------------FWFG------------------
A0A8B0LCV0_E1B19K-      ----------------------------FWFG------------------
A0A8B0LBX6_E1B19K-      ----------------------------FWFG------------------
Q2KSL3_E1B19K-01        ----------------------------FWFG------------------
Q2Y0J3_E1B19K-01        ----------------------------FWFG------------------
                                                    :*.                   

Q2KSL3_E1B19K-02        EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
Q2Y0J3_E1B19K-02        EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
A0A8B0L9Y2_E1B19K-      ------------------GDLARLVFRIKQDYR---------------EE
A0A8B0LD36_E1B19K-      ------------------GDLARLVFRIKQDYR---------------EE
A0A8B0LCV0_E1B19K-      ------------------GDLARLVFRIKQDYR---------------EE
A0A8B0LBX6_E1B19K-      ------------------GDLARLVFRIKQDYR---------------EE
Q2KSL3_E1B19K-01        ------------------GDLARLVFRIKQDYR---------------EE
Q2Y0J3_E1B19K-01        ------------------GDLARLVFRIKQDYR---------------EE
                                           : *.: :* .::**               : 

Q2KSL3_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q2Y0J3_E1B19K-02        AEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGDGYNGIVFMAN
A0A8B0L9Y2_E1B19K-      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
A0A8B0LD36_E1B19K-      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLI-
A0A8B0LCV0_E1B19K-      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
A0A8B0LBX6_E1B19K-      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
Q2KSL3_E1B19K-01        FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
Q2Y0J3_E1B19K-01        FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
                         * ::* :. . * .  :* . . .  :.::::::   *    .:.*:  

Q2KSL3_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2Y0J3_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A8B0L9Y2_E1B19K-      ---------------FILDKW----IRQTHFSKGYVLD------------
A0A8B0LD36_E1B19K-      ---------------FILDKW----IRQTHFSKGYVLD------------
A0A8B0LCV0_E1B19K-      ---------------FILDKW----IRQTHFSKGYVLD------------
A0A8B0LBX6_E1B19K-      ---------------FILDKW----IRQTHFSKGYVLD------------
Q2KSL3_E1B19K-01        ---------------FILDKW----IRQTHFSKGYVLD------------
Q2Y0J3_E1B19K-01        ---------------FILDKW----IRQTHFSKGYVLD------------
                                         :: *    :*   *   ::              

Q2KSL3_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2Y0J3_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
                                                                          

Q2KSL3_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
Q2Y0J3_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
A0A8B0L9Y2_E1B19K-      ------------------FIAAALWRTW----------------------
A0A8B0LD36_E1B19K-      ------------------FIAAALWRTW----------------------
A0A8B0LCV0_E1B19K-      ------------------FIAAALWRTW----------------------
A0A8B0LBX6_E1B19K-      ------------------FIAAALWRTW----------------------
Q2KSL3_E1B19K-01        ------------------FIAAALWRTW----------------------
Q2Y0J3_E1B19K-01        ------------------FIAAALWRTW----------------------
                                          .*.:  ...*                      

Q2KSL3_E1B19K-02        MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
Q2Y0J3_E1B19K-02        MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
A0A8B0L9Y2_E1B19K-      -----KARRMRTILDYWPVQPLGVAGILRHPP--PAVLQEEQQEDNPRA-
A0A8B0LD36_E1B19K-      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
A0A8B0LCV0_E1B19K-      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
A0A8B0LBX6_E1B19K-      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPVVLQEEQQEDNPRA-
Q2KSL3_E1B19K-01        -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
Q2Y0J3_E1B19K-01        -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
                             : ..:..:*:  ... :.::**:        :*. :: : . ** 

Q2KSL3_E1B19K-02        ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
Q2Y0J3_E1B19K-02        ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
A0A8B0L9Y2_E1B19K-      ----------------------------------GLDPPVEE
A0A8B0LD36_E1B19K-      ----------------------------------GLDPPVEE
A0A8B0LCV0_E1B19K-      ----------------------------------GLDPPVEE
A0A8B0LBX6_E1B19K-      ----------------------------------GLDPPVEE
Q2KSL3_E1B19K-01        ----------------------------------GLDPPVEE
Q2Y0J3_E1B19K-01        ----------------------------------GLDPPVEE
                                                          * .    :

© 1998-2022Legal notice