Dataset for protein E1B 19K of organism Human adenovirus B serotype 3

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KSL3_E1B19K-02      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
Q2Y0J3_E1B19K-02      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
Q2KSL3_E1B19K-01      --------------------MEVWAILEDLRQTRLLLENAS---------
Q2Y0J3_E1B19K-01      --------------------MEVWAILEDLRQTKLLLENAS---------
                                          :*     :*  : .** . **         

Q2KSL3_E1B19K-02      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
Q2Y0J3_E1B19K-02      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
Q2KSL3_E1B19K-01      ------------------------DGVSGLWR------------------
Q2Y0J3_E1B19K-01      ------------------------DGVSGLWR------------------
                                              .**:.*:                   

Q2KSL3_E1B19K-02      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
Q2Y0J3_E1B19K-02      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
Q2KSL3_E1B19K-01      ----------------------------FWFG------------------
Q2Y0J3_E1B19K-01      ----------------------------FWFG------------------
                                                  :*.                   

Q2KSL3_E1B19K-02      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
Q2Y0J3_E1B19K-02      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
Q2KSL3_E1B19K-01      ------------------GDLARLVFRIKQDYR---------------EE
Q2Y0J3_E1B19K-01      ------------------GDLARLVFRIKQDYR---------------EE
                                         : *.: :* .::**               : 

Q2KSL3_E1B19K-02      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q2Y0J3_E1B19K-02      AEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGDGYNGIVFMAN
Q2KSL3_E1B19K-01      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
Q2Y0J3_E1B19K-01      FEKLLD-DSPGLFEALNLG-HQAHFKEKVLSVLDFSTPGRTAAAVAFLT-
                       * ::* :. . * .  :* . . .  :.::::::   *    .:.*:: 

Q2KSL3_E1B19K-02      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2Y0J3_E1B19K-02      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2KSL3_E1B19K-01      ---------------FILDKW----IRQTHFSKGYVLD------------
Q2Y0J3_E1B19K-01      ---------------FILDKW----IRQTHFSKGYVLD------------
                                       :: *    :*   *   ::              

Q2KSL3_E1B19K-02      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2Y0J3_E1B19K-02      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2KSL3_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01      --------------------------------------------------
                                                                        

Q2KSL3_E1B19K-02      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
Q2Y0J3_E1B19K-02      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
Q2KSL3_E1B19K-01      ------------------FIAAALWRTW----------------------
Q2Y0J3_E1B19K-01      ------------------FIAAALWRTW----------------------
                                        .*.:  ...*                      

Q2KSL3_E1B19K-02      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
Q2Y0J3_E1B19K-02      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
Q2KSL3_E1B19K-01      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
Q2Y0J3_E1B19K-01      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
                           : ..:..:*:  ... :.::**:     :  :*. :: : . ** 

Q2KSL3_E1B19K-02      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
Q2Y0J3_E1B19K-02      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
Q2KSL3_E1B19K-01      ----------------------------------GLDPPVEE
Q2Y0J3_E1B19K-01      ----------------------------------GLDPPVEE
                                                        * .    :

© 1998-2022Legal notice