Dataset for protein adenoviridae of organism Human adenovirus A serotype 18

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :: * *  : *:.                                                                
--pevpAvLqsyqGvr----------------------------------------------------------------
memdle e glha lhgnaavegmaheeglhllagaafdhaatanvagggagaagpcggevnmeqqvqeghaldpeegps

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                * **   :: . . .* :*                   .*:.*:. * 
--------------------------------QlLQytsqqtsmhwrYlyG-------------------sTlcKvvlRv
caavnikreretvlsrlavnimsrprletvyw e  nefkngdgflq kf feqlkthwlepwediesaik fa lah p

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. .*. .    :*. .     * : .:* . .  *. .:            :. ::.  **                . *
krsYrksktntlAsyp-----GllisvDtshrviFrerv------------vtslnvssAG----------------rtV
ded kiefeiii gcayiign aiael lcdhsa qckmqgmgpgvvglggikfidfrf  dkfkgtlfeantslvlhg 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  : *  * ::.* :.*                                                               
yslnFsvTvvesWsqvS---------------------------------------------------------------
afia ln cldk ikt argctfygcrrglvgrpkskmsvkkclfekcvlalivegdahirhnaasentcfvlvkgmavl

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    :  *       :*   * : *.*. :.   *             
------------------------------------qlsWp------yMrdyMhmqLwRgwlvrrvC-------------
rhnmvcgvsdqsarryvtcadgnchalktihvvshvkhr dvcdhnmf lcs alg r amftpfq nlshtnvllepev

       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
        ::.*:                            **: :     *..: *         *. *  .: 
--------vysLs----------------------------RPvtmpvtptLrsehL---------EssDpdgn-
fsrislngifd avelykviryddtrhrcrqcecgsshlel  lllnrlee qede tlsclrtdy qr eaaek
© 1998-2020Legal notice