Dataset for protein adenoviridae of organism Human adenovirus A serotype 18

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D3JIR7_E1B19K-01      --MELEAVLQSYQGVR----------------------------------
D3JIR7_E1B19K-02      MEPDVPAELGLHAGLHGNAAVEGMAHEEGLHLLAGAAFDHAATANVAGGG
                         :: * *  : *:.                                  

D3JIR7_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02      AGAAGPCGGEVNMEQQVQEGHALDPEEGPSCAAVNIKRERETVLSRLAVN
                                                                        

D3JIR7_E1B19K-01      ------------QLLQYTSKNTSGFWRYLFG-------------------
D3JIR7_E1B19K-02      IMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQLKTHWLEPWEDIESAI
                                  * **   :: . . .* :*                   

D3JIR7_E1B19K-01      STLCKVVHRVKEDYRKEFENILAGCP-----GLLASLDLCHHSIFQEKV-
D3JIR7_E1B19K-02      KTFAKLALRPDRSYKISKTITIASYAYIIGNGAIIEVDTSDRVAFRCRMQ
                      .*:.*:. * . .*. .    :*. .     * : .:* . .  *. .: 

D3JIR7_E1B19K-01      -----------VKSLDFSSAG----------------RTVASIAFLVTVL
D3JIR7_E1B19K-02      GMGPGVVGLGGITFINVRFAGDKFKGTLFEANTSLVLHGVYFLNFSNTCV
                                 :. ::.  **                . *  : *  * :

D3JIR7_E1B19K-01      DKWSQTS-------------------------------------------
D3JIR7_E1B19K-02      ESWIKVSARGCTFYGCRRGLVGRPKSKMSVKKCLFEKCVLALIVEGDAHI
                      :.* :.*                                           

D3JIR7_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02      RHNAASENTCFVLVKGMAVLRHNMVCGVSDQSARRYVTCADGNCHALKTI
                                                                        

D3JIR7_E1B19K-01      ------QLSWD------YMLDYMAMQLWRAWLTRRVC-------------
D3JIR7_E1B19K-02      HVVSHVKHRWPVCDHNMFMRCSMHLGLRRGMFVPFQCNLSHTNVLLEPEV
                            :  *       :*   * : *.*. :.   *             

D3JIR7_E1B19K-01      --------IYSLA----------------------------RPLTMPRLP
D3JIR7_E1B19K-02      FSRISLNGVFDLSVELYKVIRYDDTRHRCRQCECGSSHLELRPVLLNVTE
                              ::.*:                            **: :    

D3JIR7_E1B19K-01      TLQEEEL---------EQRDPAAEK
D3JIR7_E1B19K-02      ELRSDHLTLSCLRTDYESSDEDGN-
                       *..: *         *. *  .: 

© 1998-2020Legal notice