Dataset for protein adenoviridae of organism Human adenovirus A serotype 18

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|D3JIR7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 18 GN=E1B19K (length=162 residues).
MELEAVLQSYQGVRQLLQYTSKNTSGFWRYLFGSTLCKVVHRVKEDYRKEFENILAGCPGLLASLDLCHHSIFQEKVVKS
LDFSSAGRTVASIAFLVTVLDKWSQTSQLSWDYMLDYMAMQLWRAWLTRRVCIYSLARPLTMPRLPTLQEEELEQRDPAA
EK
>gnl|bcl2dbpro|D3JIR7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 18 GN=E1B19K (length=474 residues).
MEPDVPAELGLHAGLHGNAAVEGMAHEEGLHLLAGAAFDHAATANVAGGGAGAAGPCGGEVNMEQQVQEGHALDPEEGPS
CAAVNIKRERETVLSRLAVNIMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQLKTHWLEPWEDIESAIKTFAKLALRP
DRSYKISKTITIASYAYIIGNGAIIEVDTSDRVAFRCRMQGMGPGVVGLGGITFINVRFAGDKFKGTLFEANTSLVLHGV
YFLNFSNTCVESWIKVSARGCTFYGCRRGLVGRPKSKMSVKKCLFEKCVLALIVEGDAHIRHNAASENTCFVLVKGMAVL
RHNMVCGVSDQSARRYVTCADGNCHALKTIHVVSHVKHRWPVCDHNMFMRCSMHLGLRRGMFVPFQCNLSHTNVLLEPEV
FSRISLNGVFDLSVELYKVIRYDDTRHRCRQCECGSSHLELRPVLLNVTEELRSDHLTLSCLRTDYESSDEDGN
© 1998-2021Legal notice