Dataset for protein E1B 19K of organism Human adenovirus 52

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                               :  *. ** :                       
meqqrqppvvgvhaglhgdgsveghaaeeglhllagaasaagpsgggdla gd  fdsrpgpssgrlgaeddpeegtsgg

        90       100       110       120       130       140       150       160
             .:. *     :.      **      * .   .::*.                            :.
arkkqktepeprnflne lelamdkqrpetr  aelede gkgelnll kygfeqlkthwlepwedmemaldtfakvalk

       170       180       190       200       210       220       230       240
 ::   : * :  . .*:*   :** :*.* :  ..::*..                      .* .. .:.*:*     
pdkeaqfa lladkkg f aldi  ga f ekiidnla ncgmqslgpgviglngvtfqnvrfp dnfagaa i stqlt

       250       260       270       280       290       300       310       320
             ::.*.     ... * .*: ::. :  .*::...:: *                             
lhgvyffnfnntcldq grvslrgcdf gc eamldriksa alkkaife cvialavegygrirnnaasengcflllkg

       330       340       350       360       370       380       390       400

       410       420       430       440       450       460       470     
     ***:                               :**  *  *: . *  .:    . **:. :.. *:
tdsfp   fngvfdmsmelfkvirydetksrcrscecganh  aq pr drte lendheelec  adldppd d
© 1998-2023Legal notice