Dataset for protein E1B 19K of organism Human adenovirus 52

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0MK43_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 52 GN=E1B19K (length=168 residues).
MDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
GLDPPVED
>gnl|bcl2dbpro|A0MK43_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 52 GN=E1B19K (length=472 residues).
MEQQRQPPVVGVHAGLHGDGSVEGHAAEEGLHLLAGAASAAGPSGGGERAGGDRESESRPGPSSGRLGAEDDPEEGTSGG
ARKKQKTEPEPRNFLNELTVSLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEMALDTFAKVALR
PDKVYTIRRTVNIKKSVYVIGHGALVQVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSVFVTSTQLTLHG
VYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKKCIFERCVIALAVEGYGRIRNNAASENGCFLLLKGTAS
VKHNMICGSGLCPSQLLTCADGNCHTLRTVHIVSHSRRTWPTFEHNMLMRCAVHLGARRGVFMPYQCNFSHTKILLETDS
FPRVCFNGVFDMSMELFKVIRYDETKSRCRSCECGANHLRLYPVTLNVTEELRTDHHMLSCLRTDYESSDEE
© 1998-2022Legal notice