Dataset for protein E1B 19K of organism Human adenovirus 52

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0MK43_E1B19K-01      ----------------------------------------------MDLL
A0MK43_E1B19K-02      MEQQRQPPVVGVHAGLHGDGSVEGHAAEEGLHLLAGAASAAGPSGGGERA
                                                                     :  

A0MK43_E1B19K-01      GNLREFD------------------------------------VVRRLLE
A0MK43_E1B19K-02      GGDRESESRPGPSSGRLGAEDDPEEGTSGGARKKQKTEPEPRNFLNELTV
                      *. ** :                                    .:. *  

A0MK43_E1B19K-01      LASDKTSRLWRFW------FGSTLSSVVYR--------------------
A0MK43_E1B19K-02      SLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEMA
                         :.      **      * .   .::*.                    

A0MK43_E1B19K-01      --------VKREQEAQFARLLADTPGVFVALDLGHHSLFQEKIIKNLTFT
A0MK43_E1B19K-02      LDTFAKVALRPDKVYTIRRTVNIKKSVYV---IGHGALVQVQTPDRVAFN
                              :. ::   : * :  . .*:*   :** :*.* :  ..::*.

A0MK43_E1B19K-01      S----------------------PGRTVASAAFITY--------------
A0MK43_E1B19K-02      CGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSVFVTSTQLTLHGVYFFNFN
                      .                      .* .. .:.*:*               

A0MK43_E1B19K-01      --ILDQWS-----NSDSHLSWEYMLDYM--AMALWRAMLRR---------
A0MK43_E1B19K-02      NTCVESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKKCIFERCVIALAVEG
                         ::.*.     ... * .*: ::. :  .*::...:: *         

A0MK43_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02      YGRIRNNAASENGCFLLLKGTASVKHNMICGSGLCPSQLLTCADGNCHTL
                                                                        

A0MK43_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02      RTVHIVSHSRRTWPTFEHNMLMRCAVHLGARRGVFMPYQCNFSHTKILLE
                                                                        

A0MK43_E1B19K-01      -----RVCI-------------------------------YLRAQPPRLD
A0MK43_E1B19K-02      TDSFPRVCFNGVFDMSMELFKVIRYDETKSRCRSCECGANHLRLYPVTLN
                           ***:                               :**  *  *:

A0MK43_E1B19K-01      RVVE-ENEPEETENLRAGLDPPVED
A0MK43_E1B19K-02      VTEELRTDHHMLSCLRTDYESSDEE
                       . *  .:    . **:. :.. *:

© 1998-2020Legal notice