Dataset for protein E1B 19K of organism Human adenovirus 11

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   : . :   .*                                   
--------------mevwailedlrktr-----qllenasdgvsG-----------------------------------
mdpadsfqqgirfg--------------dednl--mssnasfkg npeastghasgsgggtargqpesrpgpssggggva
              fhshs v nmegsq     r  ag  f c                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          .   ::
--------------------------------------------------------------------------vwrfwl
dlspelqrvltgststgrdrgvkrerassgtdarselalslmsrrrpetiwwhevqkegrdevsvlqekysleqfktpyf
                                                                           fsc  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .  .       .                                                       
ase---------larvvfrikqdyk-------------------------------------------------------
tprddwevaiknypswa-----qvritrrinirnacyisgngaevvidtqdkavirccmmdmwpgvvgmeavtfvnvkfr
eg            ki l pdkg n                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :    .      .         .   :    :::.    :  :    :  .             
---------qefekllvdgpglf----ealnlghqvhfkekvlsvldfstpgrtaaavafltfildkwipqt--------
gdgyngivfmnvtgstlhcrsvqgfnntc---------rsstfyycwlasspldksqlslkksvfqrtvlgmlnegearv
          anm  i   cpf     p vdawg  svngcs taati  a      a aaac aancn  i        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .          :    .                     
-----------------------------------------hfsrgyvldfiatalwrtw--------------------
rhcastdtgcfilikgnasvkhnmicgasderpyqmltcaggyynslmtvstvsnqrsklpvfdhnvmtkctmhaggrrg
                                          hcgmiaanh s hnpk                      

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .  :: .:*                                           .  .:   : *    ::    
-------kvrkmrvlLgywpvqplgvagil-----------------------------rhppvmpavlEe--eqqevnp
mfmpyqctqnhvlti e-------------dmnmqiwkilryddtrsrvracecggkhaqlqaltvrlt llrsdhvdil
       nmd lk   apdafsrmslt  f                              fe  cqd g d  p  l ea

       490    
....:....|....
*.  :      :  
Ragleppveeae--
 vqtdsgsstektk
 t a fa gg  sd
© 1998-2021Legal notice